Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZHY5

Protein Details
Accession A0A4Y9ZHY5   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSFKKRTRFHRHHARRSSSTSPHydrophilic
NLS Segment(s)
PositionSequence
67-87SKDGAGGGGGKRKRKEKQEKT
95-127HEKKRKELMDLKKRWEEDKAKVEKLKSSRKFRP
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR040446  RRP7  
IPR024326  RRP7_C  
Pfam View protein in Pfam  
PF12923  RRP7  
Amino Acid Sequences MSFKKRTRFHRHHARRSSSTSPTDPQRYARPELLDALANEMPLPMIVDAECGMPLDLGKWQSGQAKSKDGAGGGGGKRKRKEKQEKTGFYAFQQHEKKRKELMDLKKRWEEDKAKVEKLKSSRKFRPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.84
4 0.8
5 0.75
6 0.7
7 0.63
8 0.58
9 0.57
10 0.57
11 0.51
12 0.49
13 0.5
14 0.49
15 0.5
16 0.48
17 0.43
18 0.38
19 0.38
20 0.35
21 0.29
22 0.23
23 0.23
24 0.19
25 0.16
26 0.15
27 0.12
28 0.11
29 0.08
30 0.09
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.06
44 0.06
45 0.07
46 0.07
47 0.09
48 0.14
49 0.16
50 0.21
51 0.21
52 0.23
53 0.23
54 0.24
55 0.23
56 0.18
57 0.16
58 0.12
59 0.15
60 0.12
61 0.18
62 0.2
63 0.24
64 0.28
65 0.35
66 0.41
67 0.48
68 0.58
69 0.63
70 0.71
71 0.78
72 0.8
73 0.79
74 0.79
75 0.68
76 0.58
77 0.57
78 0.47
79 0.46
80 0.48
81 0.49
82 0.52
83 0.55
84 0.58
85 0.56
86 0.57
87 0.58
88 0.59
89 0.63
90 0.64
91 0.67
92 0.7
93 0.7
94 0.7
95 0.62
96 0.62
97 0.58
98 0.56
99 0.59
100 0.59
101 0.59
102 0.62
103 0.62
104 0.61
105 0.63
106 0.65
107 0.65
108 0.67