Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZIK5

Protein Details
Accession A0A4Y9ZIK5    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
254-277LQNTLAARRSRKRKLEYQRELEDSHydrophilic
NLS Segment(s)
PositionSequence
261-266RRSRKR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MLSPKNADQLASSADPKVSMPPVPPPTMQDEAAAQAIIDALQASPAFGGGGFDMMSDFLTSPLESPLDDDMLTTPALGSGDMMDSPDIFTSPVIPGFGGAFDDLPSLFPDMQGYEPLEPKPRHPQFHPSSVNTSPNFDDMYKMPSPDTPSMDPSSLHTSPAGLNDRSSAARRKSHPTGTRKNVTPESLVPLDAPIQNRNYVTPSQTSRKELPVTFARKRARSAAFGEDDTLAPEDGGSSSVTQTEEEAIKAKRLQNTLAARRSRKRKLEYQRELEDSLEAERREKEMWKARALVLEALLRDKGHDVPRIDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.22
5 0.2
6 0.19
7 0.19
8 0.27
9 0.33
10 0.36
11 0.36
12 0.35
13 0.39
14 0.4
15 0.39
16 0.31
17 0.26
18 0.24
19 0.24
20 0.21
21 0.14
22 0.1
23 0.09
24 0.08
25 0.06
26 0.05
27 0.04
28 0.05
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.04
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.09
50 0.09
51 0.08
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.11
59 0.11
60 0.09
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.06
78 0.07
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.05
88 0.05
89 0.06
90 0.05
91 0.06
92 0.06
93 0.08
94 0.07
95 0.07
96 0.08
97 0.08
98 0.09
99 0.1
100 0.11
101 0.11
102 0.12
103 0.14
104 0.21
105 0.21
106 0.24
107 0.33
108 0.38
109 0.4
110 0.41
111 0.5
112 0.47
113 0.57
114 0.58
115 0.5
116 0.49
117 0.48
118 0.51
119 0.41
120 0.38
121 0.29
122 0.25
123 0.24
124 0.18
125 0.17
126 0.12
127 0.17
128 0.15
129 0.15
130 0.15
131 0.15
132 0.19
133 0.2
134 0.23
135 0.19
136 0.21
137 0.22
138 0.22
139 0.21
140 0.19
141 0.23
142 0.2
143 0.19
144 0.16
145 0.15
146 0.15
147 0.19
148 0.2
149 0.13
150 0.13
151 0.14
152 0.15
153 0.16
154 0.18
155 0.2
156 0.2
157 0.26
158 0.29
159 0.36
160 0.4
161 0.47
162 0.53
163 0.56
164 0.62
165 0.64
166 0.67
167 0.63
168 0.63
169 0.57
170 0.51
171 0.44
172 0.35
173 0.32
174 0.26
175 0.24
176 0.18
177 0.16
178 0.16
179 0.16
180 0.16
181 0.14
182 0.15
183 0.17
184 0.17
185 0.17
186 0.19
187 0.18
188 0.18
189 0.2
190 0.24
191 0.28
192 0.31
193 0.36
194 0.35
195 0.39
196 0.41
197 0.37
198 0.38
199 0.4
200 0.44
201 0.43
202 0.49
203 0.5
204 0.48
205 0.51
206 0.52
207 0.48
208 0.44
209 0.44
210 0.42
211 0.39
212 0.36
213 0.35
214 0.28
215 0.25
216 0.22
217 0.19
218 0.12
219 0.09
220 0.08
221 0.07
222 0.06
223 0.07
224 0.06
225 0.06
226 0.06
227 0.08
228 0.09
229 0.09
230 0.09
231 0.11
232 0.11
233 0.11
234 0.15
235 0.15
236 0.18
237 0.22
238 0.26
239 0.29
240 0.31
241 0.32
242 0.36
243 0.45
244 0.51
245 0.54
246 0.58
247 0.6
248 0.67
249 0.75
250 0.76
251 0.76
252 0.75
253 0.77
254 0.81
255 0.85
256 0.86
257 0.85
258 0.82
259 0.77
260 0.71
261 0.61
262 0.5
263 0.4
264 0.33
265 0.3
266 0.23
267 0.21
268 0.21
269 0.23
270 0.24
271 0.27
272 0.33
273 0.38
274 0.43
275 0.46
276 0.48
277 0.47
278 0.5
279 0.49
280 0.41
281 0.34
282 0.31
283 0.27
284 0.25
285 0.25
286 0.19
287 0.19
288 0.19
289 0.22
290 0.25
291 0.31
292 0.31