Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K2SH59

Protein Details
Accession K2SH59   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-91GLGSRRLRPRRLQRRTPPRRCVTAHydrophilic
NLS Segment(s)
PositionSequence
71-85SRRLRPRRLQRRTPP
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008701  NPP1  
Pfam View protein in Pfam  
PF05630  NPP1  
Amino Acid Sequences MYSWFMPKDQIVDGGGNAGHRQDWENVVVCHTSVLSFLSLPLSTWQFLTSFVSQIDCHRQPGQREPQGLGSRRLRPRRLQRRTPPRRCVTATACRSSTSPTSRRTTRCSSRPVQAATSGWPTGPICPPRRGTLSSPPTSARPTCLSRTATESPTWTRSTPALRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.13
5 0.11
6 0.1
7 0.1
8 0.12
9 0.13
10 0.15
11 0.17
12 0.2
13 0.2
14 0.21
15 0.21
16 0.18
17 0.16
18 0.13
19 0.1
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.09
28 0.11
29 0.12
30 0.11
31 0.12
32 0.12
33 0.1
34 0.11
35 0.15
36 0.13
37 0.13
38 0.12
39 0.14
40 0.14
41 0.16
42 0.23
43 0.2
44 0.23
45 0.26
46 0.29
47 0.31
48 0.4
49 0.47
50 0.44
51 0.44
52 0.42
53 0.46
54 0.49
55 0.48
56 0.45
57 0.4
58 0.44
59 0.5
60 0.56
61 0.52
62 0.54
63 0.63
64 0.69
65 0.72
66 0.74
67 0.77
68 0.81
69 0.88
70 0.9
71 0.88
72 0.81
73 0.78
74 0.7
75 0.66
76 0.61
77 0.6
78 0.54
79 0.49
80 0.44
81 0.4
82 0.37
83 0.34
84 0.33
85 0.3
86 0.3
87 0.32
88 0.38
89 0.43
90 0.47
91 0.5
92 0.54
93 0.56
94 0.57
95 0.59
96 0.57
97 0.58
98 0.6
99 0.56
100 0.49
101 0.43
102 0.37
103 0.32
104 0.32
105 0.26
106 0.19
107 0.19
108 0.17
109 0.17
110 0.23
111 0.27
112 0.28
113 0.34
114 0.37
115 0.39
116 0.43
117 0.45
118 0.44
119 0.47
120 0.51
121 0.49
122 0.49
123 0.47
124 0.45
125 0.46
126 0.42
127 0.36
128 0.33
129 0.34
130 0.36
131 0.41
132 0.41
133 0.37
134 0.44
135 0.44
136 0.42
137 0.39
138 0.39
139 0.37
140 0.39
141 0.4
142 0.33
143 0.31
144 0.34