Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZSX4

Protein Details
Accession A0A4Y9ZSX4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
129-155LQSTSLTGRPQRKRKGRDLTEIKNCVCHydrophilic
661-704DEAPKKAKAKAPKKPKAPKAPKPPKATQPPKPKQPKGKAAQQATHydrophilic
NLS Segment(s)
PositionSequence
666-700PKKAKAKAPKKPKAPKAPKPPKATQPPKPKQPKGK
Subcellular Location(s) plas 15, nucl 6.5, cyto_nucl 4.5, cyto 1.5, mito 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR001650  Helicase_C  
IPR022673  Hexokinase_C  
IPR027417  P-loop_NTPase  
IPR038718  SNF2-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0016301  F:kinase activity  
GO:0016773  F:phosphotransferase activity, alcohol group as acceptor  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00271  Helicase_C  
PF03727  Hexokinase_2  
PROSITE View protein in PROSITE  
PS51194  HELICASE_CTER  
CDD cd18793  SF2_C_SNF  
Amino Acid Sequences MRQPPEDEDEEYMEASDQTETDSDSDQGYSAIQDKAVDETVSDGQYDKDAVEREDDGISGDLVGAVTASDAVMGVGATDHGAVQDRLSVDGGIDTVSATPNSVALAVATEAQSIEAVGPGQSSATAPALQSTSLTGRPQRKRKGRDLTEIKNCVCRERAQAGGNDVVECGKPGCETRWTLGNTGKVVLTNTRNTPSKAPELRMGVQAEQQAAQTVFGRQWGVVVIDEIHQCRNVGQFFMGVTALTSMSIGVLGMSATPVSSKAMDLWNIGRALRIKFFISNDAEARDMNRAQTRGLRKDRKKXAVDPESVTNVLRGADTDMVSEVSKEMAPYVAQMRXHFSGLVIRRTIASVDWEGKPLLTLRPYTEHIFTMRLYQHEYDALEALLEQSVHTQEGRRGASKDFYLNFHRALIHPAANNDIPNVVYPVDLKTYESYPSRKLDAVIAIARHHLALDDAPPLSYSADPDNDDIGVFEPAPIAEDKDDPLPDNLGPDKIVLFAFFPTTYALITSVLTAHGIKFIEMHGNHKASQRPLILEEFRKQDRDGARVLIMSSVGGVGLNMAFANIMIILDVVWDDSADSQAIGRIWRQMQQKRVRIYRLIGSDTPDVALNNLSFDKGHIMEAFTNKRGVLDKILTALEADQDESELVEMEADANALGQENDDEAPKKAKAKAPKKPKAPKAPKPPKATQPPKPKQPKGKAAQQATQPVASSSKASTVPPAASSSVSQAKSTLPPEDVTLRDAAIVRWACSIVVRRGARLSACAVATVAEQMGYVNRLGSDATLARPGPIAHYPKFEERMREALRLLVGKDVEQQIDIGLAKDGSGVGAALSALQAVKQLRAGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.12
4 0.08
5 0.09
6 0.09
7 0.1
8 0.11
9 0.13
10 0.13
11 0.13
12 0.14
13 0.12
14 0.12
15 0.11
16 0.11
17 0.13
18 0.13
19 0.12
20 0.13
21 0.14
22 0.17
23 0.18
24 0.16
25 0.13
26 0.16
27 0.18
28 0.18
29 0.17
30 0.15
31 0.14
32 0.15
33 0.15
34 0.12
35 0.13
36 0.15
37 0.15
38 0.18
39 0.19
40 0.19
41 0.19
42 0.19
43 0.16
44 0.15
45 0.14
46 0.1
47 0.09
48 0.07
49 0.07
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.08
69 0.08
70 0.08
71 0.12
72 0.12
73 0.13
74 0.14
75 0.13
76 0.11
77 0.11
78 0.11
79 0.08
80 0.07
81 0.06
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.08
90 0.07
91 0.06
92 0.07
93 0.06
94 0.08
95 0.08
96 0.08
97 0.07
98 0.08
99 0.07
100 0.06
101 0.06
102 0.05
103 0.06
104 0.05
105 0.06
106 0.05
107 0.05
108 0.06
109 0.06
110 0.07
111 0.09
112 0.09
113 0.09
114 0.11
115 0.12
116 0.12
117 0.11
118 0.12
119 0.13
120 0.16
121 0.19
122 0.25
123 0.34
124 0.44
125 0.54
126 0.62
127 0.69
128 0.75
129 0.82
130 0.86
131 0.84
132 0.85
133 0.85
134 0.84
135 0.84
136 0.82
137 0.73
138 0.69
139 0.61
140 0.54
141 0.47
142 0.41
143 0.38
144 0.36
145 0.4
146 0.37
147 0.39
148 0.38
149 0.39
150 0.36
151 0.29
152 0.25
153 0.2
154 0.16
155 0.14
156 0.11
157 0.08
158 0.09
159 0.1
160 0.13
161 0.17
162 0.2
163 0.22
164 0.29
165 0.3
166 0.32
167 0.34
168 0.36
169 0.31
170 0.3
171 0.28
172 0.21
173 0.21
174 0.24
175 0.24
176 0.24
177 0.26
178 0.31
179 0.34
180 0.35
181 0.38
182 0.37
183 0.43
184 0.43
185 0.43
186 0.43
187 0.45
188 0.45
189 0.46
190 0.42
191 0.34
192 0.32
193 0.31
194 0.26
195 0.21
196 0.19
197 0.16
198 0.14
199 0.14
200 0.12
201 0.11
202 0.1
203 0.11
204 0.12
205 0.09
206 0.1
207 0.1
208 0.1
209 0.09
210 0.09
211 0.08
212 0.1
213 0.12
214 0.13
215 0.13
216 0.13
217 0.13
218 0.13
219 0.17
220 0.15
221 0.14
222 0.13
223 0.13
224 0.13
225 0.13
226 0.12
227 0.08
228 0.07
229 0.07
230 0.06
231 0.05
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.04
246 0.05
247 0.06
248 0.06
249 0.08
250 0.1
251 0.12
252 0.13
253 0.14
254 0.16
255 0.16
256 0.16
257 0.17
258 0.17
259 0.18
260 0.18
261 0.19
262 0.17
263 0.19
264 0.2
265 0.23
266 0.23
267 0.24
268 0.23
269 0.22
270 0.21
271 0.19
272 0.19
273 0.17
274 0.15
275 0.15
276 0.18
277 0.18
278 0.18
279 0.25
280 0.31
281 0.37
282 0.47
283 0.54
284 0.57
285 0.66
286 0.74
287 0.75
288 0.75
289 0.74
290 0.71
291 0.7
292 0.66
293 0.6
294 0.56
295 0.51
296 0.43
297 0.35
298 0.28
299 0.19
300 0.16
301 0.12
302 0.09
303 0.09
304 0.09
305 0.09
306 0.09
307 0.09
308 0.09
309 0.09
310 0.07
311 0.06
312 0.06
313 0.06
314 0.06
315 0.05
316 0.05
317 0.07
318 0.11
319 0.12
320 0.13
321 0.15
322 0.16
323 0.16
324 0.17
325 0.15
326 0.16
327 0.19
328 0.2
329 0.2
330 0.19
331 0.18
332 0.18
333 0.18
334 0.14
335 0.11
336 0.11
337 0.13
338 0.13
339 0.14
340 0.14
341 0.13
342 0.14
343 0.12
344 0.12
345 0.11
346 0.11
347 0.12
348 0.15
349 0.18
350 0.2
351 0.2
352 0.19
353 0.18
354 0.19
355 0.17
356 0.19
357 0.18
358 0.16
359 0.18
360 0.17
361 0.17
362 0.17
363 0.16
364 0.12
365 0.11
366 0.1
367 0.07
368 0.06
369 0.06
370 0.05
371 0.04
372 0.04
373 0.04
374 0.05
375 0.05
376 0.06
377 0.06
378 0.08
379 0.14
380 0.15
381 0.17
382 0.18
383 0.19
384 0.21
385 0.21
386 0.23
387 0.19
388 0.2
389 0.22
390 0.23
391 0.22
392 0.21
393 0.2
394 0.17
395 0.19
396 0.18
397 0.16
398 0.15
399 0.15
400 0.16
401 0.16
402 0.16
403 0.12
404 0.1
405 0.08
406 0.08
407 0.08
408 0.06
409 0.05
410 0.06
411 0.07
412 0.08
413 0.08
414 0.08
415 0.09
416 0.09
417 0.12
418 0.14
419 0.16
420 0.18
421 0.2
422 0.21
423 0.2
424 0.2
425 0.19
426 0.17
427 0.17
428 0.15
429 0.14
430 0.13
431 0.13
432 0.12
433 0.1
434 0.09
435 0.06
436 0.05
437 0.05
438 0.06
439 0.07
440 0.06
441 0.06
442 0.07
443 0.07
444 0.07
445 0.07
446 0.07
447 0.08
448 0.09
449 0.1
450 0.11
451 0.11
452 0.1
453 0.1
454 0.09
455 0.08
456 0.07
457 0.06
458 0.05
459 0.05
460 0.05
461 0.06
462 0.06
463 0.06
464 0.06
465 0.06
466 0.07
467 0.09
468 0.1
469 0.1
470 0.1
471 0.11
472 0.1
473 0.12
474 0.12
475 0.1
476 0.1
477 0.1
478 0.09
479 0.09
480 0.09
481 0.07
482 0.07
483 0.06
484 0.07
485 0.07
486 0.07
487 0.07
488 0.07
489 0.07
490 0.07
491 0.07
492 0.06
493 0.06
494 0.06
495 0.06
496 0.06
497 0.06
498 0.06
499 0.06
500 0.07
501 0.07
502 0.07
503 0.07
504 0.08
505 0.13
506 0.14
507 0.17
508 0.19
509 0.21
510 0.23
511 0.27
512 0.3
513 0.25
514 0.3
515 0.28
516 0.25
517 0.26
518 0.28
519 0.28
520 0.28
521 0.31
522 0.31
523 0.31
524 0.32
525 0.29
526 0.31
527 0.3
528 0.29
529 0.27
530 0.24
531 0.23
532 0.21
533 0.21
534 0.15
535 0.12
536 0.09
537 0.07
538 0.05
539 0.04
540 0.03
541 0.03
542 0.03
543 0.03
544 0.03
545 0.03
546 0.03
547 0.03
548 0.03
549 0.03
550 0.03
551 0.03
552 0.02
553 0.03
554 0.02
555 0.03
556 0.03
557 0.03
558 0.03
559 0.03
560 0.03
561 0.03
562 0.04
563 0.04
564 0.04
565 0.04
566 0.06
567 0.07
568 0.08
569 0.08
570 0.12
571 0.13
572 0.2
573 0.29
574 0.33
575 0.42
576 0.51
577 0.57
578 0.61
579 0.66
580 0.65
581 0.6
582 0.57
583 0.54
584 0.48
585 0.46
586 0.38
587 0.36
588 0.33
589 0.3
590 0.27
591 0.21
592 0.17
593 0.13
594 0.13
595 0.09
596 0.09
597 0.09
598 0.09
599 0.08
600 0.09
601 0.11
602 0.11
603 0.12
604 0.11
605 0.12
606 0.15
607 0.21
608 0.24
609 0.23
610 0.23
611 0.22
612 0.23
613 0.23
614 0.22
615 0.21
616 0.19
617 0.19
618 0.2
619 0.2
620 0.18
621 0.16
622 0.15
623 0.11
624 0.09
625 0.09
626 0.07
627 0.07
628 0.07
629 0.07
630 0.07
631 0.05
632 0.05
633 0.04
634 0.04
635 0.04
636 0.04
637 0.04
638 0.04
639 0.04
640 0.04
641 0.04
642 0.04
643 0.04
644 0.04
645 0.05
646 0.06
647 0.08
648 0.1
649 0.11
650 0.15
651 0.17
652 0.21
653 0.26
654 0.31
655 0.41
656 0.5
657 0.58
658 0.66
659 0.73
660 0.8
661 0.84
662 0.89
663 0.89
664 0.9
665 0.9
666 0.9
667 0.92
668 0.9
669 0.89
670 0.86
671 0.85
672 0.85
673 0.84
674 0.83
675 0.83
676 0.84
677 0.86
678 0.89
679 0.88
680 0.88
681 0.88
682 0.89
683 0.85
684 0.85
685 0.84
686 0.79
687 0.76
688 0.71
689 0.68
690 0.6
691 0.53
692 0.44
693 0.36
694 0.31
695 0.26
696 0.22
697 0.15
698 0.17
699 0.17
700 0.18
701 0.2
702 0.21
703 0.21
704 0.21
705 0.23
706 0.2
707 0.19
708 0.2
709 0.21
710 0.26
711 0.25
712 0.24
713 0.23
714 0.24
715 0.28
716 0.3
717 0.28
718 0.22
719 0.22
720 0.25
721 0.28
722 0.27
723 0.24
724 0.22
725 0.19
726 0.19
727 0.19
728 0.16
729 0.19
730 0.19
731 0.18
732 0.19
733 0.19
734 0.17
735 0.2
736 0.26
737 0.23
738 0.31
739 0.31
740 0.32
741 0.34
742 0.37
743 0.34
744 0.31
745 0.29
746 0.24
747 0.23
748 0.21
749 0.18
750 0.16
751 0.15
752 0.14
753 0.11
754 0.07
755 0.07
756 0.07
757 0.08
758 0.09
759 0.09
760 0.08
761 0.08
762 0.09
763 0.09
764 0.09
765 0.11
766 0.12
767 0.13
768 0.17
769 0.17
770 0.17
771 0.19
772 0.19
773 0.19
774 0.25
775 0.3
776 0.29
777 0.35
778 0.39
779 0.44
780 0.51
781 0.5
782 0.49
783 0.48
784 0.55
785 0.53
786 0.51
787 0.45
788 0.42
789 0.42
790 0.38
791 0.34
792 0.29
793 0.25
794 0.23
795 0.29
796 0.28
797 0.25
798 0.22
799 0.22
800 0.17
801 0.19
802 0.18
803 0.13
804 0.11
805 0.1
806 0.1
807 0.1
808 0.1
809 0.07
810 0.07
811 0.06
812 0.04
813 0.05
814 0.05
815 0.05
816 0.05
817 0.05
818 0.05
819 0.05
820 0.09
821 0.1
822 0.12
823 0.14