Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZHQ0

Protein Details
Accession A0A4Y9ZHQ0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
151-171VLAERDQRVRRVRWRRADLPQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 4.5, cyto_nucl 3.5, pero 3, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR023753  FAD/NAD-binding_dom  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF07992  Pyr_redox_2  
Amino Acid Sequences MAPTAVNGVSGKEGQSSKMHSRVVIIGSGPAGHTAAIYLARANLNPVLFEGFMANGFAAGGQLTTTTDVENFPGFPTGVLGPELMDKFRAQSLRFGTRIITETVAKLDLSRRPFRYWREYQENDEPETADTIILATGASAKTPRSQGRGDVLAERDQRVRRVRWRRADLPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.27
4 0.31
5 0.37
6 0.37
7 0.33
8 0.35
9 0.35
10 0.33
11 0.28
12 0.22
13 0.16
14 0.15
15 0.15
16 0.13
17 0.1
18 0.08
19 0.07
20 0.06
21 0.05
22 0.06
23 0.06
24 0.06
25 0.06
26 0.08
27 0.08
28 0.09
29 0.1
30 0.12
31 0.11
32 0.11
33 0.11
34 0.11
35 0.11
36 0.11
37 0.09
38 0.07
39 0.07
40 0.07
41 0.06
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.02
49 0.03
50 0.03
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.1
76 0.12
77 0.11
78 0.15
79 0.2
80 0.24
81 0.25
82 0.24
83 0.23
84 0.22
85 0.23
86 0.19
87 0.17
88 0.12
89 0.12
90 0.12
91 0.12
92 0.1
93 0.1
94 0.12
95 0.15
96 0.2
97 0.27
98 0.29
99 0.34
100 0.39
101 0.45
102 0.51
103 0.53
104 0.56
105 0.59
106 0.59
107 0.61
108 0.64
109 0.61
110 0.54
111 0.47
112 0.39
113 0.3
114 0.28
115 0.22
116 0.12
117 0.09
118 0.07
119 0.06
120 0.05
121 0.05
122 0.03
123 0.05
124 0.05
125 0.06
126 0.07
127 0.08
128 0.12
129 0.19
130 0.23
131 0.26
132 0.28
133 0.32
134 0.37
135 0.4
136 0.38
137 0.37
138 0.36
139 0.38
140 0.39
141 0.37
142 0.38
143 0.37
144 0.43
145 0.45
146 0.5
147 0.54
148 0.62
149 0.7
150 0.75
151 0.81