Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A674

Protein Details
Accession A0A4Z0A674   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-52AKVHHKTPLKLGPRRRARRCELRVSRQKRLQPBasic
NLS Segment(s)
PositionSequence
29-39LKLGPRRRARR
Subcellular Location(s) nucl 11, mito 6.5, cyto_mito 5.5, cyto 3.5, pero 3
Family & Domain DBs
Amino Acid Sequences MLLPLFEMICIQELKGSPGCAKVHHKTPLKLGPRRRARRCELRVSRQKRLQPMEQLPPEYIVTSKKQCCYIPELHYCIGVDADTLYDYALKHCLMPSNVGFASDDARRFCGLLEATKGLARLSGAILFLQEPVWSAEDPWLLARHSNHNWFYHMNVLNGPPDEEVFDIVRQELAISGTPKWYQIVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.2
4 0.19
5 0.25
6 0.26
7 0.28
8 0.36
9 0.37
10 0.43
11 0.5
12 0.56
13 0.53
14 0.61
15 0.65
16 0.66
17 0.68
18 0.7
19 0.71
20 0.75
21 0.82
22 0.83
23 0.83
24 0.82
25 0.86
26 0.83
27 0.84
28 0.83
29 0.83
30 0.85
31 0.84
32 0.84
33 0.8
34 0.78
35 0.76
36 0.73
37 0.68
38 0.67
39 0.65
40 0.64
41 0.6
42 0.56
43 0.48
44 0.43
45 0.37
46 0.28
47 0.23
48 0.17
49 0.18
50 0.23
51 0.26
52 0.26
53 0.3
54 0.3
55 0.32
56 0.35
57 0.37
58 0.37
59 0.38
60 0.4
61 0.36
62 0.36
63 0.33
64 0.27
65 0.21
66 0.14
67 0.08
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.07
77 0.07
78 0.07
79 0.07
80 0.1
81 0.09
82 0.12
83 0.11
84 0.14
85 0.14
86 0.14
87 0.14
88 0.11
89 0.13
90 0.12
91 0.14
92 0.11
93 0.12
94 0.12
95 0.12
96 0.12
97 0.13
98 0.12
99 0.12
100 0.14
101 0.13
102 0.14
103 0.15
104 0.15
105 0.11
106 0.1
107 0.09
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.06
119 0.07
120 0.09
121 0.08
122 0.08
123 0.11
124 0.11
125 0.11
126 0.12
127 0.12
128 0.11
129 0.15
130 0.17
131 0.22
132 0.27
133 0.34
134 0.36
135 0.36
136 0.39
137 0.37
138 0.36
139 0.37
140 0.34
141 0.28
142 0.26
143 0.26
144 0.26
145 0.25
146 0.25
147 0.17
148 0.15
149 0.15
150 0.13
151 0.14
152 0.13
153 0.13
154 0.13
155 0.12
156 0.12
157 0.11
158 0.1
159 0.09
160 0.09
161 0.12
162 0.13
163 0.14
164 0.18
165 0.18
166 0.19