Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZYM2

Protein Details
Accession A0A4Y9ZYM2    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
153-179TTPSGARLSRTRRRSRRRGDDQARVGPHydrophilic
NLS Segment(s)
PositionSequence
122-136PAPRKRAKPPPAPQP
161-170SRTRRRSRRR
215-225RRDPAARRRHG
239-262PHARERARRPVRFPVDRRRAGFHR
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 9.5, mito 2
Family & Domain DBs
Amino Acid Sequences MLPMTLEGTPMKLPPELWSEILRLATDVPYALDTNIASTHPFAHDGAYLVDLLPDSKYHSHPLTAAQKTMRTLALTCRAFCGEITPRLYSIPLCRTLDAAPRYTARSSMMGSKCALPKHAQPAPRKRAKPPPAPQPSSSKRPTSAGCTSTRTTTPSGARLSRTRRRSRRRGDDQARVGPAEPDYRMAQRALRDASAVVGDRDLRQGRISAEAAPRRDPAARRRHGQDPGRMFGATHLLPHARERARRPVRFPVDRRRAGFHRPPPGPSDGLLPFGGSPSPGLPAWPVGSGWPGVSVLARVFVGSICXEPGLLVIGGGTGTGVCEDDEDDDVIELGAEDDGEDVIELSAAEVELDPSALDVDDSVPDVDDSKVEXXDKSMLTVDESVEEADGPVEVVDETAKEVEXSVAEXXSLLRVDTVLVELTGXGRMVGXSVAEVVLGGGGXDPEXPXXXXMNIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.24
4 0.26
5 0.27
6 0.26
7 0.28
8 0.28
9 0.24
10 0.19
11 0.17
12 0.16
13 0.14
14 0.12
15 0.11
16 0.12
17 0.12
18 0.11
19 0.12
20 0.11
21 0.12
22 0.12
23 0.12
24 0.11
25 0.11
26 0.14
27 0.13
28 0.15
29 0.14
30 0.15
31 0.15
32 0.15
33 0.15
34 0.14
35 0.12
36 0.1
37 0.11
38 0.09
39 0.09
40 0.08
41 0.08
42 0.11
43 0.15
44 0.17
45 0.22
46 0.24
47 0.25
48 0.26
49 0.34
50 0.39
51 0.38
52 0.4
53 0.37
54 0.38
55 0.38
56 0.4
57 0.33
58 0.24
59 0.23
60 0.26
61 0.33
62 0.32
63 0.31
64 0.31
65 0.31
66 0.29
67 0.28
68 0.27
69 0.24
70 0.28
71 0.31
72 0.3
73 0.29
74 0.29
75 0.3
76 0.26
77 0.26
78 0.25
79 0.28
80 0.29
81 0.29
82 0.3
83 0.32
84 0.38
85 0.35
86 0.32
87 0.28
88 0.28
89 0.31
90 0.3
91 0.28
92 0.22
93 0.21
94 0.2
95 0.27
96 0.27
97 0.26
98 0.26
99 0.3
100 0.31
101 0.3
102 0.31
103 0.25
104 0.29
105 0.35
106 0.39
107 0.41
108 0.47
109 0.57
110 0.65
111 0.71
112 0.7
113 0.68
114 0.75
115 0.78
116 0.79
117 0.76
118 0.77
119 0.77
120 0.78
121 0.74
122 0.73
123 0.69
124 0.67
125 0.64
126 0.56
127 0.48
128 0.47
129 0.46
130 0.43
131 0.43
132 0.39
133 0.37
134 0.38
135 0.37
136 0.36
137 0.35
138 0.31
139 0.27
140 0.27
141 0.26
142 0.27
143 0.3
144 0.29
145 0.32
146 0.36
147 0.43
148 0.46
149 0.54
150 0.59
151 0.66
152 0.74
153 0.81
154 0.85
155 0.87
156 0.89
157 0.9
158 0.88
159 0.87
160 0.82
161 0.77
162 0.68
163 0.57
164 0.47
165 0.37
166 0.3
167 0.23
168 0.17
169 0.13
170 0.14
171 0.14
172 0.15
173 0.15
174 0.16
175 0.16
176 0.19
177 0.18
178 0.17
179 0.16
180 0.15
181 0.14
182 0.13
183 0.12
184 0.08
185 0.07
186 0.07
187 0.07
188 0.12
189 0.12
190 0.11
191 0.12
192 0.13
193 0.13
194 0.15
195 0.16
196 0.15
197 0.2
198 0.24
199 0.25
200 0.25
201 0.25
202 0.23
203 0.26
204 0.26
205 0.29
206 0.36
207 0.39
208 0.41
209 0.45
210 0.5
211 0.54
212 0.56
213 0.55
214 0.48
215 0.46
216 0.43
217 0.39
218 0.32
219 0.25
220 0.23
221 0.16
222 0.11
223 0.11
224 0.1
225 0.11
226 0.12
227 0.19
228 0.18
229 0.23
230 0.27
231 0.37
232 0.46
233 0.49
234 0.52
235 0.55
236 0.61
237 0.65
238 0.68
239 0.68
240 0.68
241 0.7
242 0.67
243 0.63
244 0.58
245 0.57
246 0.59
247 0.55
248 0.55
249 0.51
250 0.51
251 0.49
252 0.48
253 0.41
254 0.33
255 0.3
256 0.21
257 0.22
258 0.2
259 0.17
260 0.13
261 0.13
262 0.12
263 0.07
264 0.07
265 0.05
266 0.07
267 0.07
268 0.07
269 0.07
270 0.08
271 0.09
272 0.09
273 0.09
274 0.07
275 0.09
276 0.09
277 0.08
278 0.07
279 0.06
280 0.06
281 0.06
282 0.07
283 0.06
284 0.06
285 0.06
286 0.05
287 0.06
288 0.06
289 0.08
290 0.07
291 0.08
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.05
298 0.04
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.02
305 0.02
306 0.03
307 0.03
308 0.03
309 0.04
310 0.04
311 0.06
312 0.07
313 0.07
314 0.07
315 0.07
316 0.07
317 0.07
318 0.06
319 0.05
320 0.04
321 0.03
322 0.03
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.04
331 0.03
332 0.03
333 0.04
334 0.04
335 0.04
336 0.04
337 0.04
338 0.04
339 0.05
340 0.04
341 0.04
342 0.05
343 0.04
344 0.04
345 0.04
346 0.05
347 0.05
348 0.07
349 0.07
350 0.07
351 0.07
352 0.08
353 0.08
354 0.08
355 0.11
356 0.13
357 0.13
358 0.13
359 0.14
360 0.13
361 0.16
362 0.17
363 0.14
364 0.12
365 0.12
366 0.13
367 0.13
368 0.13
369 0.11
370 0.09
371 0.08
372 0.08
373 0.07
374 0.06
375 0.05
376 0.04
377 0.05
378 0.04
379 0.05
380 0.05
381 0.05
382 0.07
383 0.07
384 0.07
385 0.07
386 0.07
387 0.08
388 0.09
389 0.09
390 0.09
391 0.09
392 0.09
393 0.1
394 0.1
395 0.1
396 0.08
397 0.08
398 0.08
399 0.07
400 0.08
401 0.07
402 0.07
403 0.07
404 0.08
405 0.08
406 0.07
407 0.06
408 0.05
409 0.06
410 0.06
411 0.06
412 0.06
413 0.05
414 0.05
415 0.05
416 0.05
417 0.05
418 0.04
419 0.04
420 0.04
421 0.04
422 0.05
423 0.05