Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A1L1

Protein Details
Accession A0A4Z0A1L1   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22SPFFFIKKKDGKLRPVQDYRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 6, mito 6, mito_nucl 6, cyto_pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR000477  RT_dom  
Pfam View protein in Pfam  
PF00078  RVT_1  
CDD cd01647  RT_LTR  
Amino Acid Sequences MASPFFFIKKKDGKLRPVQDYRLLNKGTIPNKYPLPLIGELIDQIKDAKYFTKMDIRWGYNNIRIKEGDKWKAAFWMKYGLFEPTVMFFGLCNSPATFQAFMNEIFHDLIREGHVILVTEKVLKILRENHLMLKPTKCTFEAPEVDYLGLIVGNGQVRMDPKKVEAITEWPVPTNKKGIQQFLGFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.8
4 0.79
5 0.75
6 0.73
7 0.72
8 0.66
9 0.64
10 0.56
11 0.46
12 0.43
13 0.47
14 0.43
15 0.41
16 0.41
17 0.37
18 0.39
19 0.4
20 0.36
21 0.29
22 0.3
23 0.25
24 0.23
25 0.19
26 0.17
27 0.17
28 0.17
29 0.15
30 0.1
31 0.1
32 0.09
33 0.09
34 0.09
35 0.1
36 0.12
37 0.14
38 0.16
39 0.24
40 0.24
41 0.32
42 0.38
43 0.39
44 0.39
45 0.41
46 0.42
47 0.4
48 0.47
49 0.4
50 0.35
51 0.33
52 0.32
53 0.36
54 0.41
55 0.4
56 0.36
57 0.36
58 0.34
59 0.4
60 0.4
61 0.33
62 0.26
63 0.28
64 0.25
65 0.25
66 0.25
67 0.2
68 0.18
69 0.17
70 0.16
71 0.09
72 0.1
73 0.08
74 0.07
75 0.06
76 0.07
77 0.07
78 0.08
79 0.08
80 0.07
81 0.08
82 0.09
83 0.11
84 0.1
85 0.1
86 0.1
87 0.11
88 0.11
89 0.11
90 0.1
91 0.09
92 0.09
93 0.09
94 0.08
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.09
111 0.12
112 0.17
113 0.21
114 0.26
115 0.27
116 0.3
117 0.33
118 0.36
119 0.36
120 0.33
121 0.34
122 0.3
123 0.32
124 0.28
125 0.27
126 0.27
127 0.32
128 0.32
129 0.3
130 0.31
131 0.29
132 0.28
133 0.25
134 0.21
135 0.13
136 0.09
137 0.07
138 0.04
139 0.05
140 0.06
141 0.07
142 0.07
143 0.08
144 0.11
145 0.15
146 0.17
147 0.17
148 0.18
149 0.26
150 0.26
151 0.27
152 0.27
153 0.28
154 0.31
155 0.35
156 0.34
157 0.29
158 0.32
159 0.34
160 0.34
161 0.36
162 0.35
163 0.39
164 0.44
165 0.48
166 0.5