Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A2P5

Protein Details
Accession A0A4Z0A2P5   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-24KQETYIQQRAEQKRNKRSNLETHydrophilic
NLS Segment(s)
PositionSequence
163-171KRPYKKKKT
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR015195  SLIDE  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF09111  SLIDE  
Amino Acid Sequences MIKQETYIQQRAEQKRNKRSNLETLLAKKISSVRYPMQELELNYPTTKGKVYSEEEDRYLLCRLNYYGMRADDVYERIKKDISEFPVFRFDWFFKSRSTQELQRRCNTLLGMIEKEAEGKEESMPATKASGSTSRGKKRGLDDIKDSRASTPASSTPAASSTKRPYKKKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.81
4 0.82
5 0.81
6 0.78
7 0.78
8 0.76
9 0.71
10 0.67
11 0.61
12 0.61
13 0.53
14 0.46
15 0.37
16 0.35
17 0.34
18 0.31
19 0.32
20 0.29
21 0.34
22 0.37
23 0.36
24 0.35
25 0.34
26 0.32
27 0.33
28 0.31
29 0.27
30 0.25
31 0.25
32 0.21
33 0.19
34 0.19
35 0.14
36 0.13
37 0.18
38 0.22
39 0.26
40 0.31
41 0.32
42 0.32
43 0.31
44 0.29
45 0.26
46 0.23
47 0.19
48 0.13
49 0.12
50 0.12
51 0.16
52 0.16
53 0.17
54 0.19
55 0.18
56 0.19
57 0.18
58 0.19
59 0.15
60 0.17
61 0.18
62 0.16
63 0.17
64 0.16
65 0.17
66 0.16
67 0.18
68 0.21
69 0.22
70 0.26
71 0.26
72 0.27
73 0.32
74 0.32
75 0.29
76 0.26
77 0.22
78 0.21
79 0.23
80 0.22
81 0.18
82 0.23
83 0.23
84 0.25
85 0.28
86 0.31
87 0.38
88 0.46
89 0.5
90 0.5
91 0.53
92 0.5
93 0.48
94 0.4
95 0.33
96 0.27
97 0.24
98 0.21
99 0.18
100 0.17
101 0.15
102 0.15
103 0.13
104 0.11
105 0.09
106 0.08
107 0.09
108 0.1
109 0.11
110 0.12
111 0.13
112 0.11
113 0.12
114 0.11
115 0.11
116 0.12
117 0.16
118 0.17
119 0.26
120 0.35
121 0.42
122 0.46
123 0.49
124 0.51
125 0.52
126 0.59
127 0.58
128 0.55
129 0.55
130 0.59
131 0.62
132 0.6
133 0.56
134 0.46
135 0.42
136 0.38
137 0.3
138 0.26
139 0.23
140 0.25
141 0.25
142 0.24
143 0.22
144 0.24
145 0.26
146 0.24
147 0.29
148 0.35
149 0.44
150 0.53
151 0.61