Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZVL3

Protein Details
Accession A0A4Y9ZVL3   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MAIKTPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-45KKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFK
Subcellular Location(s) nucl 13.5, mito_nucl 12, mito 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKTPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPSIGYGSNKKTRHLLPSGLKKFLVNNIREVELLLMHNKTYAAEIAHNVSSRNRALILERAKVLGLKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.9
4 0.92
5 0.9
6 0.9
7 0.87
8 0.85
9 0.82
10 0.74
11 0.65
12 0.59
13 0.56
14 0.54
15 0.56
16 0.57
17 0.52
18 0.5
19 0.5
20 0.55
21 0.59
22 0.59
23 0.59
24 0.61
25 0.7
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.62
34 0.61
35 0.6
36 0.59
37 0.53
38 0.45
39 0.39
40 0.29
41 0.26
42 0.2
43 0.19
44 0.25
45 0.25
46 0.26
47 0.3
48 0.31
49 0.33
50 0.32
51 0.35
52 0.34
53 0.44
54 0.46
55 0.43
56 0.41
57 0.36
58 0.34
59 0.35
60 0.35
61 0.25
62 0.26
63 0.26
64 0.27
65 0.26
66 0.25
67 0.19
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.09
74 0.09
75 0.08
76 0.08
77 0.09
78 0.08
79 0.09
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.15
86 0.18
87 0.18
88 0.18
89 0.16
90 0.15
91 0.18
92 0.25
93 0.29
94 0.28
95 0.28
96 0.28
97 0.27
98 0.27
99 0.25
100 0.22
101 0.18
102 0.16
103 0.2
104 0.25
105 0.26
106 0.27
107 0.31
108 0.28