Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A6W4

Protein Details
Accession A0A4Z0A6W4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-127FQRFEVMLQKKQRRDRVRKALKAATKAHydrophilic
NLS Segment(s)
PositionSequence
116-133KKQRRDRVRKALKAATKA
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
IPR002784  Ribosomal_L14e_dom  
IPR039660  Ribosomal_protein_L14  
IPR041985  RPL14_KOW  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01929  Ribosomal_L14e  
CDD cd06088  KOW_RPL14  
Amino Acid Sequences MTYXRLTRPXVVLLXDGPSAGRVAVIAEXXXHNRAIIDGPTTGVPRQSFPYRHLTLTPLSVKGLPRASRTGIVKKYLEKESTIEKWEKSSWAQKRAAVEKRRSLNDFQRFEVMLQKKQRRDRVRKALKAATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.1
5 0.08
6 0.07
7 0.07
8 0.07
9 0.11
10 0.12
11 0.14
12 0.15
13 0.15
14 0.15
15 0.14
16 0.13
17 0.1
18 0.09
19 0.07
20 0.08
21 0.09
22 0.11
23 0.11
24 0.13
25 0.13
26 0.14
27 0.18
28 0.24
29 0.24
30 0.27
31 0.35
32 0.34
33 0.34
34 0.34
35 0.31
36 0.26
37 0.29
38 0.27
39 0.19
40 0.18
41 0.18
42 0.18
43 0.19
44 0.23
45 0.2
46 0.21
47 0.22
48 0.23
49 0.25
50 0.27
51 0.31
52 0.28
53 0.3
54 0.29
55 0.3
56 0.33
57 0.33
58 0.31
59 0.25
60 0.25
61 0.27
62 0.28
63 0.29
64 0.26
65 0.23
66 0.25
67 0.25
68 0.25
69 0.23
70 0.3
71 0.33
72 0.39
73 0.41
74 0.41
75 0.46
76 0.53
77 0.58
78 0.58
79 0.57
80 0.58
81 0.62
82 0.65
83 0.62
84 0.6
85 0.6
86 0.62
87 0.58
88 0.52
89 0.49
90 0.45
91 0.42
92 0.45
93 0.39
94 0.37
95 0.44
96 0.51
97 0.55
98 0.64
99 0.73
100 0.75
101 0.81
102 0.84
103 0.86
104 0.89
105 0.89
106 0.88
107 0.87