Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K2RZ50

Protein Details
Accession K2RZ50   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-31GRSACRSIRPGKSKKGREWRSLLIHydrophilic
NLS Segment(s)
PositionSequence
16-24RPGKSKKGR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRRPAPLGRSACRSIRPGKSKKGREWRSLLIALTAAHAICTAHPSRPPQSLLRRSLLCHSNLWALFSLNSYTAPVFRSIMACFPRVSAFDAKPTGPEPSGKQSDIFTSFALSISRPTCCLRQAREAPQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.6
4 0.61
5 0.67
6 0.73
7 0.78
8 0.83
9 0.85
10 0.83
11 0.82
12 0.81
13 0.75
14 0.71
15 0.65
16 0.54
17 0.44
18 0.36
19 0.28
20 0.22
21 0.17
22 0.1
23 0.07
24 0.07
25 0.06
26 0.05
27 0.09
28 0.1
29 0.11
30 0.14
31 0.19
32 0.22
33 0.26
34 0.29
35 0.32
36 0.41
37 0.46
38 0.48
39 0.48
40 0.45
41 0.43
42 0.45
43 0.42
44 0.33
45 0.26
46 0.24
47 0.23
48 0.22
49 0.21
50 0.17
51 0.13
52 0.12
53 0.12
54 0.11
55 0.07
56 0.07
57 0.07
58 0.06
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.1
65 0.09
66 0.15
67 0.16
68 0.16
69 0.15
70 0.15
71 0.16
72 0.16
73 0.19
74 0.19
75 0.18
76 0.21
77 0.23
78 0.22
79 0.23
80 0.23
81 0.22
82 0.18
83 0.2
84 0.2
85 0.26
86 0.3
87 0.29
88 0.29
89 0.27
90 0.3
91 0.31
92 0.28
93 0.2
94 0.18
95 0.17
96 0.17
97 0.17
98 0.13
99 0.14
100 0.15
101 0.16
102 0.17
103 0.2
104 0.23
105 0.28
106 0.35
107 0.36
108 0.45
109 0.52