Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A9W8

Protein Details
Accession A0A4Z0A9W8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-33ADNERRKRPKAAKPSANQAGTHydrophilic
62-85STVTPSSKAKEKQKIKKLSAPRPFHydrophilic
NLS Segment(s)
PositionSequence
15-25NERRKRPKAAK
72-78EKQKIKK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MAGAAKRKLGDAADNERRKRPKAAKPSANQAGTSASAILHAADGTTPTAEPTTDQPTAATDSTVTPSSKAKEKQKIKKLSAPRPFPTVPTSVSATGPRSAHHEGKNYIAVTRKTPLGAYLRRCKDIVLKDGYKTLHLSAMGAAIPHLSTLAVSIPLILPFPADEIHTEVLTGTVEVQDELIPEDEDEDISYRTRGKSTLSIVIKIGDGVDEKAAVGGKWATRGKRRSGPATIAQAGQSNGKGSERIFVEVPEQDDMDQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.62
4 0.66
5 0.63
6 0.67
7 0.67
8 0.67
9 0.7
10 0.77
11 0.79
12 0.79
13 0.85
14 0.84
15 0.76
16 0.65
17 0.55
18 0.47
19 0.37
20 0.32
21 0.22
22 0.12
23 0.11
24 0.11
25 0.1
26 0.07
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.06
34 0.07
35 0.08
36 0.08
37 0.09
38 0.12
39 0.17
40 0.17
41 0.18
42 0.17
43 0.18
44 0.22
45 0.21
46 0.17
47 0.12
48 0.12
49 0.15
50 0.17
51 0.16
52 0.13
53 0.16
54 0.19
55 0.26
56 0.32
57 0.39
58 0.47
59 0.57
60 0.66
61 0.73
62 0.8
63 0.78
64 0.8
65 0.81
66 0.8
67 0.8
68 0.77
69 0.7
70 0.66
71 0.61
72 0.55
73 0.48
74 0.4
75 0.32
76 0.27
77 0.27
78 0.21
79 0.22
80 0.22
81 0.2
82 0.21
83 0.2
84 0.17
85 0.21
86 0.24
87 0.28
88 0.29
89 0.33
90 0.3
91 0.33
92 0.36
93 0.3
94 0.27
95 0.27
96 0.24
97 0.21
98 0.22
99 0.2
100 0.17
101 0.17
102 0.18
103 0.2
104 0.24
105 0.28
106 0.36
107 0.37
108 0.39
109 0.39
110 0.36
111 0.36
112 0.35
113 0.35
114 0.32
115 0.31
116 0.3
117 0.33
118 0.32
119 0.27
120 0.23
121 0.18
122 0.13
123 0.12
124 0.11
125 0.08
126 0.09
127 0.08
128 0.07
129 0.06
130 0.04
131 0.04
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.06
151 0.08
152 0.09
153 0.09
154 0.09
155 0.08
156 0.08
157 0.08
158 0.07
159 0.05
160 0.04
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.07
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.08
177 0.09
178 0.11
179 0.12
180 0.13
181 0.14
182 0.16
183 0.2
184 0.24
185 0.32
186 0.31
187 0.32
188 0.31
189 0.31
190 0.28
191 0.22
192 0.18
193 0.11
194 0.09
195 0.09
196 0.09
197 0.08
198 0.08
199 0.08
200 0.09
201 0.08
202 0.08
203 0.1
204 0.1
205 0.17
206 0.22
207 0.28
208 0.36
209 0.42
210 0.48
211 0.54
212 0.61
213 0.61
214 0.62
215 0.63
216 0.61
217 0.63
218 0.57
219 0.5
220 0.44
221 0.4
222 0.34
223 0.31
224 0.24
225 0.18
226 0.18
227 0.18
228 0.18
229 0.16
230 0.21
231 0.2
232 0.23
233 0.21
234 0.21
235 0.24
236 0.25
237 0.27
238 0.23
239 0.22