Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZXA8

Protein Details
Accession A0A4Y9ZXA8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
197-224YYPPSESKLRKSKSKRSLGKRTRSSSLSHydrophilic
NLS Segment(s)
PositionSequence
204-218KLRKSKSKRSLGKRT
Subcellular Location(s) extr 10, nucl 5, cyto 4, mito_nucl 4, mito 3, plas 3
Family & Domain DBs
Amino Acid Sequences MLLKFSSSDLLNSRLLTADSLTPIYTICTTRFIGISRYSRGAVLRRRTAIYDAQKHDRALAVIEWAGRVPCRIRIGTEELTDVEDLFDGCSGVDALQKTVSIPARCGGAWTATRGSLKLEDKETGVLKSAFFRNSICFNGRFIAAPLPGLGSDLFVLKSQSVLAEVEIIASFFIMEIIRRNVFNVAPHAFDRHLGPYYPPSESKLRKSKSKRSLGKRTRSSSLSLDFSDIAKKLKFSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.16
5 0.14
6 0.14
7 0.15
8 0.14
9 0.13
10 0.12
11 0.14
12 0.14
13 0.14
14 0.13
15 0.16
16 0.17
17 0.19
18 0.2
19 0.2
20 0.22
21 0.27
22 0.31
23 0.31
24 0.32
25 0.31
26 0.31
27 0.34
28 0.37
29 0.39
30 0.43
31 0.45
32 0.46
33 0.47
34 0.47
35 0.47
36 0.48
37 0.49
38 0.49
39 0.48
40 0.52
41 0.54
42 0.52
43 0.49
44 0.41
45 0.32
46 0.25
47 0.2
48 0.14
49 0.12
50 0.12
51 0.11
52 0.1
53 0.1
54 0.08
55 0.1
56 0.09
57 0.13
58 0.17
59 0.17
60 0.18
61 0.22
62 0.29
63 0.3
64 0.29
65 0.25
66 0.22
67 0.23
68 0.21
69 0.17
70 0.1
71 0.07
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.11
87 0.15
88 0.14
89 0.14
90 0.14
91 0.15
92 0.15
93 0.16
94 0.12
95 0.11
96 0.11
97 0.13
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.15
104 0.16
105 0.16
106 0.17
107 0.16
108 0.17
109 0.18
110 0.18
111 0.14
112 0.14
113 0.12
114 0.1
115 0.13
116 0.15
117 0.13
118 0.13
119 0.14
120 0.14
121 0.17
122 0.19
123 0.19
124 0.17
125 0.17
126 0.18
127 0.17
128 0.16
129 0.14
130 0.14
131 0.12
132 0.11
133 0.1
134 0.09
135 0.09
136 0.09
137 0.08
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.07
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.07
154 0.06
155 0.06
156 0.05
157 0.04
158 0.04
159 0.03
160 0.04
161 0.03
162 0.04
163 0.07
164 0.11
165 0.13
166 0.13
167 0.14
168 0.16
169 0.17
170 0.19
171 0.21
172 0.19
173 0.21
174 0.22
175 0.23
176 0.22
177 0.22
178 0.22
179 0.2
180 0.2
181 0.18
182 0.2
183 0.23
184 0.25
185 0.27
186 0.26
187 0.27
188 0.34
189 0.39
190 0.46
191 0.51
192 0.54
193 0.61
194 0.7
195 0.76
196 0.78
197 0.83
198 0.83
199 0.84
200 0.9
201 0.9
202 0.91
203 0.9
204 0.86
205 0.82
206 0.74
207 0.68
208 0.63
209 0.58
210 0.52
211 0.43
212 0.39
213 0.33
214 0.32
215 0.31
216 0.27
217 0.25
218 0.22
219 0.22