Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZPA4

Protein Details
Accession A0A4Y9ZPA4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
4-28STMQARYRVKSAKQKRPLKPSSPFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MIGSTMQARYRVKSAKQKRPLKPSSPFIGRLPTDLHLLILQNLPVPDIPAYARASRALARLAASDPVWDRRWTALDAEKYAFGLVLDDLAARASKAATDVPPTLDVADDDFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.74
4 0.81
5 0.83
6 0.87
7 0.87
8 0.85
9 0.82
10 0.78
11 0.76
12 0.71
13 0.65
14 0.57
15 0.55
16 0.47
17 0.4
18 0.36
19 0.29
20 0.25
21 0.22
22 0.21
23 0.14
24 0.14
25 0.13
26 0.11
27 0.1
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.09
37 0.11
38 0.11
39 0.12
40 0.11
41 0.12
42 0.13
43 0.14
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.09
52 0.1
53 0.14
54 0.15
55 0.15
56 0.15
57 0.16
58 0.18
59 0.18
60 0.2
61 0.22
62 0.23
63 0.25
64 0.25
65 0.23
66 0.21
67 0.2
68 0.17
69 0.1
70 0.08
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.05
80 0.05
81 0.05
82 0.07
83 0.09
84 0.1
85 0.15
86 0.17
87 0.19
88 0.2
89 0.2
90 0.19
91 0.17
92 0.16