Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K2RHS0

Protein Details
Accession K2RHS0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
512-535QRRLRAPDPRRPLRRDARPRAQLQBasic
NLS Segment(s)
PositionSequence
492-544RQRARRSARLGLHPKRVLGAQRRLRAPDPRRPLRRDARPRAQLQAGPRRRGDR
598-626RQPGREEPLRRAARLPHRALVRRRPPDGR
657-686RVQRAGRARPAGRLQRLLRRRGSRAGGPRG
Subcellular Location(s) extr 11, mito 9, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000269  Cu_amine_oxidase  
IPR015798  Cu_amine_oxidase_C  
IPR036460  Cu_amine_oxidase_C_sf  
IPR016182  Cu_amine_oxidase_N-reg  
IPR015800  Cu_amine_oxidase_N2  
IPR015328  DUF1965  
Gene Ontology GO:0005507  F:copper ion binding  
GO:0008131  F:primary amine oxidase activity  
GO:0048038  F:quinone binding  
GO:0009308  P:amine metabolic process  
Pfam View protein in Pfam  
PF01179  Cu_amine_oxid  
PF02727  Cu_amine_oxidN2  
PF09248  DUF1965  
Amino Acid Sequences MKASLSGWASGLAFFCFLANHANVVSCKFMPRSPRPFLQEEYNHYGAHQHAKRQATGSQCAPPGAQTIQAPKSNIWAGLNEQEAAEVTAWLHEQLSLNLTAAARAGDWDNAILLVELMIPNKTDALPYLDNNAPPPERYAHVILDIRASEEPYYQSLLVGPLPVGSGNTRYEPLDFPFTKKSGGRIRALDDISASIAAYRLLYTITASIADITQELWNGTVEGKESDVAQIVSQYPLGQDDGITQWFQFLGQPTNGFEADTLLPLGLYFSLNITGRDPNLWKLQGWYYNGVFYETTEDFKSAFAAPGFEKLAPNVAGQWTSTDQTGEVSALDDLAPPMTVAPSGSRYSVDEQEKYVKWMDFEFYIAFSRDTGVRLFDIKYRGERIIYELGLEEALAHYAGNDPVLSGIAYLDSWLRLPRARDISEHHLLQRRDPPDTHQQHLPVRDHRRLPHPAPQRLPVRQRDQERLLHAPQYMHGGKLRLHVFVQLLHGRQRARRSARLGLHPKRVLGAQRRLRAPDPRRPLRRDARPRAQLQAGPRRRGDRQHAHNDHPRPDDRRVPVGEGQAAQHDEAAARHGIQRGPGQAELGAQRRDAVHGRQPGREEPLRRAARLPHRALVRRRPPDGREQHEPGQRGQLGDARPVRHEAQGYGAAVGGRVQRAGRARPAGRLQRLLRRRGSRAGGPRGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.09
5 0.13
6 0.13
7 0.14
8 0.14
9 0.17
10 0.18
11 0.2
12 0.23
13 0.18
14 0.22
15 0.23
16 0.26
17 0.33
18 0.42
19 0.49
20 0.53
21 0.6
22 0.62
23 0.64
24 0.65
25 0.65
26 0.62
27 0.61
28 0.62
29 0.56
30 0.5
31 0.45
32 0.44
33 0.37
34 0.41
35 0.36
36 0.35
37 0.39
38 0.43
39 0.46
40 0.46
41 0.47
42 0.43
43 0.45
44 0.42
45 0.42
46 0.39
47 0.38
48 0.35
49 0.31
50 0.29
51 0.24
52 0.23
53 0.2
54 0.26
55 0.31
56 0.34
57 0.35
58 0.32
59 0.36
60 0.35
61 0.34
62 0.28
63 0.24
64 0.23
65 0.26
66 0.27
67 0.22
68 0.19
69 0.18
70 0.17
71 0.16
72 0.13
73 0.08
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.1
81 0.1
82 0.13
83 0.12
84 0.12
85 0.14
86 0.14
87 0.12
88 0.11
89 0.11
90 0.08
91 0.09
92 0.09
93 0.08
94 0.09
95 0.09
96 0.08
97 0.08
98 0.08
99 0.07
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.09
112 0.15
113 0.17
114 0.18
115 0.23
116 0.25
117 0.25
118 0.27
119 0.3
120 0.24
121 0.23
122 0.25
123 0.22
124 0.21
125 0.25
126 0.26
127 0.22
128 0.26
129 0.28
130 0.25
131 0.25
132 0.24
133 0.22
134 0.19
135 0.19
136 0.14
137 0.14
138 0.15
139 0.13
140 0.16
141 0.14
142 0.13
143 0.13
144 0.13
145 0.12
146 0.11
147 0.09
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.1
154 0.11
155 0.13
156 0.14
157 0.14
158 0.16
159 0.17
160 0.19
161 0.25
162 0.24
163 0.27
164 0.31
165 0.31
166 0.33
167 0.33
168 0.37
169 0.37
170 0.42
171 0.43
172 0.41
173 0.44
174 0.46
175 0.45
176 0.38
177 0.29
178 0.24
179 0.19
180 0.17
181 0.13
182 0.06
183 0.06
184 0.06
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.06
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.06
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.08
215 0.08
216 0.07
217 0.08
218 0.08
219 0.09
220 0.08
221 0.08
222 0.07
223 0.08
224 0.08
225 0.07
226 0.06
227 0.07
228 0.08
229 0.09
230 0.09
231 0.08
232 0.08
233 0.08
234 0.08
235 0.08
236 0.09
237 0.11
238 0.11
239 0.12
240 0.13
241 0.16
242 0.15
243 0.14
244 0.12
245 0.11
246 0.11
247 0.1
248 0.09
249 0.07
250 0.07
251 0.06
252 0.07
253 0.04
254 0.04
255 0.04
256 0.04
257 0.07
258 0.08
259 0.08
260 0.1
261 0.11
262 0.11
263 0.13
264 0.14
265 0.15
266 0.18
267 0.19
268 0.17
269 0.18
270 0.21
271 0.24
272 0.25
273 0.25
274 0.21
275 0.22
276 0.22
277 0.2
278 0.17
279 0.12
280 0.15
281 0.12
282 0.13
283 0.12
284 0.13
285 0.12
286 0.12
287 0.13
288 0.09
289 0.1
290 0.08
291 0.09
292 0.09
293 0.11
294 0.12
295 0.11
296 0.11
297 0.1
298 0.12
299 0.11
300 0.11
301 0.1
302 0.09
303 0.09
304 0.09
305 0.1
306 0.09
307 0.09
308 0.09
309 0.08
310 0.08
311 0.08
312 0.08
313 0.06
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.04
320 0.04
321 0.04
322 0.04
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.04
329 0.07
330 0.08
331 0.08
332 0.09
333 0.1
334 0.13
335 0.19
336 0.21
337 0.19
338 0.19
339 0.24
340 0.24
341 0.24
342 0.24
343 0.19
344 0.17
345 0.17
346 0.16
347 0.11
348 0.12
349 0.1
350 0.09
351 0.1
352 0.1
353 0.09
354 0.08
355 0.09
356 0.08
357 0.09
358 0.08
359 0.08
360 0.08
361 0.1
362 0.1
363 0.13
364 0.15
365 0.15
366 0.17
367 0.19
368 0.19
369 0.18
370 0.18
371 0.19
372 0.19
373 0.18
374 0.16
375 0.13
376 0.12
377 0.12
378 0.11
379 0.07
380 0.03
381 0.04
382 0.03
383 0.03
384 0.03
385 0.04
386 0.04
387 0.05
388 0.04
389 0.04
390 0.04
391 0.05
392 0.04
393 0.03
394 0.03
395 0.03
396 0.03
397 0.04
398 0.04
399 0.04
400 0.05
401 0.06
402 0.07
403 0.09
404 0.11
405 0.17
406 0.23
407 0.24
408 0.25
409 0.3
410 0.36
411 0.38
412 0.38
413 0.36
414 0.37
415 0.36
416 0.38
417 0.4
418 0.34
419 0.33
420 0.33
421 0.34
422 0.38
423 0.42
424 0.41
425 0.37
426 0.4
427 0.41
428 0.47
429 0.46
430 0.44
431 0.47
432 0.5
433 0.52
434 0.51
435 0.54
436 0.56
437 0.55
438 0.55
439 0.58
440 0.59
441 0.58
442 0.61
443 0.61
444 0.6
445 0.64
446 0.63
447 0.62
448 0.61
449 0.63
450 0.63
451 0.61
452 0.59
453 0.56
454 0.53
455 0.47
456 0.43
457 0.39
458 0.32
459 0.27
460 0.29
461 0.25
462 0.21
463 0.21
464 0.2
465 0.2
466 0.26
467 0.26
468 0.21
469 0.21
470 0.22
471 0.2
472 0.2
473 0.23
474 0.2
475 0.21
476 0.23
477 0.27
478 0.27
479 0.3
480 0.36
481 0.4
482 0.43
483 0.48
484 0.5
485 0.56
486 0.59
487 0.65
488 0.69
489 0.67
490 0.7
491 0.64
492 0.59
493 0.52
494 0.49
495 0.46
496 0.45
497 0.48
498 0.47
499 0.52
500 0.55
501 0.58
502 0.59
503 0.61
504 0.59
505 0.59
506 0.61
507 0.65
508 0.7
509 0.71
510 0.77
511 0.77
512 0.81
513 0.82
514 0.82
515 0.82
516 0.82
517 0.8
518 0.76
519 0.7
520 0.62
521 0.6
522 0.61
523 0.59
524 0.55
525 0.56
526 0.56
527 0.55
528 0.6
529 0.61
530 0.6
531 0.62
532 0.68
533 0.7
534 0.73
535 0.77
536 0.76
537 0.72
538 0.69
539 0.65
540 0.59
541 0.59
542 0.6
543 0.56
544 0.57
545 0.53
546 0.51
547 0.49
548 0.47
549 0.44
550 0.37
551 0.33
552 0.29
553 0.27
554 0.22
555 0.18
556 0.15
557 0.12
558 0.11
559 0.13
560 0.1
561 0.1
562 0.13
563 0.16
564 0.17
565 0.19
566 0.23
567 0.25
568 0.27
569 0.27
570 0.24
571 0.22
572 0.24
573 0.26
574 0.28
575 0.25
576 0.21
577 0.23
578 0.22
579 0.26
580 0.27
581 0.27
582 0.3
583 0.38
584 0.41
585 0.44
586 0.47
587 0.47
588 0.51
589 0.52
590 0.48
591 0.46
592 0.53
593 0.53
594 0.51
595 0.5
596 0.52
597 0.56
598 0.62
599 0.6
600 0.56
601 0.6
602 0.67
603 0.72
604 0.74
605 0.74
606 0.72
607 0.74
608 0.76
609 0.71
610 0.74
611 0.75
612 0.71
613 0.7
614 0.68
615 0.7
616 0.69
617 0.67
618 0.58
619 0.57
620 0.52
621 0.44
622 0.39
623 0.36
624 0.31
625 0.38
626 0.4
627 0.34
628 0.34
629 0.38
630 0.38
631 0.36
632 0.36
633 0.29
634 0.29
635 0.32
636 0.3
637 0.26
638 0.24
639 0.2
640 0.18
641 0.2
642 0.17
643 0.13
644 0.14
645 0.14
646 0.19
647 0.25
648 0.3
649 0.35
650 0.42
651 0.43
652 0.5
653 0.59
654 0.64
655 0.65
656 0.69
657 0.67
658 0.69
659 0.75
660 0.75
661 0.75
662 0.73
663 0.73
664 0.72
665 0.72
666 0.71
667 0.73
668 0.74