Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZIC8

Protein Details
Accession A0A4Y9ZIC8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-55VESAVPKKKKHIVRRLVLYTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_mito 12.333, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019133  MIC60  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF09731  Mitofilin  
Amino Acid Sequences MYRALPVARQAASPASKGLVRVSRRRFATETSETVESAVPKKKKHIVRRLVLYTAAATTTYYVGSAFVAFNNPVYYDFFINRVPFGPSVIEFGENHGWDNLTLQDVVDNTIEGGIKTYTFARKQLGYASEEVIDEAKKAEKKAEQKVKGVKDATEKAVESGEGILDRLKTDVHVSKVHEKSVKAAAIAKHRAEQFSEGVDDLIHKAEHALSSESPIASQPEATTTPGQPTNAVPHVLGPKEGELELETTEFVEQPKKSDKDVYDAPLPIGFEPPPGYKRPTPPKPAAEPEQAAGAVEPLPLVAPVVAGLSSSEPVISHLASTIDNLAAFLNNNPAAATQARGVLDTARTDLTELAHDFDKLREEEQHKLEQELDEQARQYTLKLLEIELDAQDKLDHQEAGFKEYLDEEKAKFAQAYREKLDRELETQREIINERLKEEVIAQGIELQRRWIRDIKVHVEQERGGRLAKLDELAANLKRLERIALDNSTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.23
4 0.24
5 0.29
6 0.3
7 0.35
8 0.43
9 0.5
10 0.56
11 0.58
12 0.63
13 0.59
14 0.56
15 0.58
16 0.54
17 0.51
18 0.47
19 0.45
20 0.39
21 0.37
22 0.34
23 0.28
24 0.28
25 0.33
26 0.33
27 0.34
28 0.42
29 0.5
30 0.58
31 0.66
32 0.71
33 0.72
34 0.77
35 0.84
36 0.81
37 0.75
38 0.66
39 0.56
40 0.46
41 0.36
42 0.27
43 0.17
44 0.12
45 0.11
46 0.1
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.09
53 0.08
54 0.08
55 0.1
56 0.11
57 0.11
58 0.12
59 0.12
60 0.12
61 0.14
62 0.16
63 0.16
64 0.17
65 0.18
66 0.21
67 0.21
68 0.21
69 0.19
70 0.2
71 0.18
72 0.18
73 0.18
74 0.15
75 0.17
76 0.17
77 0.18
78 0.15
79 0.19
80 0.22
81 0.2
82 0.21
83 0.18
84 0.18
85 0.16
86 0.17
87 0.13
88 0.1
89 0.1
90 0.09
91 0.09
92 0.09
93 0.11
94 0.1
95 0.09
96 0.07
97 0.09
98 0.09
99 0.08
100 0.09
101 0.07
102 0.07
103 0.08
104 0.12
105 0.16
106 0.18
107 0.21
108 0.23
109 0.24
110 0.25
111 0.3
112 0.29
113 0.26
114 0.26
115 0.25
116 0.22
117 0.21
118 0.2
119 0.16
120 0.12
121 0.1
122 0.09
123 0.13
124 0.14
125 0.15
126 0.19
127 0.24
128 0.32
129 0.43
130 0.52
131 0.52
132 0.57
133 0.65
134 0.65
135 0.65
136 0.59
137 0.51
138 0.48
139 0.47
140 0.43
141 0.37
142 0.33
143 0.27
144 0.26
145 0.22
146 0.15
147 0.12
148 0.09
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.11
158 0.15
159 0.17
160 0.2
161 0.24
162 0.33
163 0.34
164 0.38
165 0.37
166 0.34
167 0.34
168 0.36
169 0.33
170 0.24
171 0.27
172 0.26
173 0.31
174 0.35
175 0.33
176 0.31
177 0.32
178 0.32
179 0.29
180 0.27
181 0.2
182 0.17
183 0.17
184 0.13
185 0.11
186 0.1
187 0.1
188 0.08
189 0.08
190 0.06
191 0.05
192 0.06
193 0.06
194 0.07
195 0.08
196 0.09
197 0.08
198 0.1
199 0.12
200 0.11
201 0.1
202 0.11
203 0.11
204 0.09
205 0.09
206 0.07
207 0.08
208 0.09
209 0.11
210 0.12
211 0.11
212 0.14
213 0.15
214 0.16
215 0.14
216 0.14
217 0.16
218 0.16
219 0.16
220 0.13
221 0.14
222 0.17
223 0.16
224 0.16
225 0.12
226 0.11
227 0.11
228 0.11
229 0.09
230 0.06
231 0.07
232 0.07
233 0.07
234 0.06
235 0.05
236 0.06
237 0.06
238 0.06
239 0.1
240 0.09
241 0.12
242 0.2
243 0.21
244 0.22
245 0.27
246 0.28
247 0.29
248 0.32
249 0.32
250 0.28
251 0.27
252 0.26
253 0.21
254 0.21
255 0.16
256 0.14
257 0.11
258 0.08
259 0.1
260 0.12
261 0.13
262 0.15
263 0.2
264 0.22
265 0.31
266 0.41
267 0.47
268 0.52
269 0.57
270 0.6
271 0.61
272 0.63
273 0.6
274 0.54
275 0.47
276 0.4
277 0.34
278 0.28
279 0.22
280 0.16
281 0.11
282 0.07
283 0.05
284 0.05
285 0.04
286 0.04
287 0.04
288 0.04
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.04
296 0.04
297 0.05
298 0.05
299 0.05
300 0.04
301 0.06
302 0.07
303 0.07
304 0.06
305 0.07
306 0.08
307 0.08
308 0.08
309 0.08
310 0.07
311 0.07
312 0.07
313 0.07
314 0.06
315 0.06
316 0.06
317 0.1
318 0.09
319 0.09
320 0.09
321 0.09
322 0.11
323 0.11
324 0.12
325 0.08
326 0.11
327 0.11
328 0.12
329 0.12
330 0.11
331 0.12
332 0.12
333 0.13
334 0.1
335 0.1
336 0.1
337 0.11
338 0.1
339 0.12
340 0.11
341 0.12
342 0.12
343 0.13
344 0.13
345 0.14
346 0.17
347 0.15
348 0.16
349 0.21
350 0.24
351 0.3
352 0.34
353 0.4
354 0.36
355 0.36
356 0.37
357 0.3
358 0.29
359 0.29
360 0.27
361 0.21
362 0.21
363 0.2
364 0.2
365 0.19
366 0.18
367 0.16
368 0.15
369 0.17
370 0.17
371 0.17
372 0.17
373 0.18
374 0.19
375 0.14
376 0.15
377 0.11
378 0.11
379 0.11
380 0.1
381 0.12
382 0.12
383 0.12
384 0.1
385 0.17
386 0.18
387 0.23
388 0.23
389 0.21
390 0.19
391 0.21
392 0.23
393 0.2
394 0.22
395 0.17
396 0.21
397 0.22
398 0.23
399 0.22
400 0.22
401 0.28
402 0.33
403 0.39
404 0.39
405 0.45
406 0.45
407 0.47
408 0.51
409 0.43
410 0.41
411 0.42
412 0.41
413 0.38
414 0.38
415 0.36
416 0.33
417 0.33
418 0.34
419 0.34
420 0.32
421 0.3
422 0.31
423 0.3
424 0.28
425 0.27
426 0.24
427 0.18
428 0.17
429 0.15
430 0.18
431 0.21
432 0.23
433 0.22
434 0.24
435 0.25
436 0.27
437 0.32
438 0.34
439 0.35
440 0.4
441 0.49
442 0.5
443 0.57
444 0.61
445 0.6
446 0.57
447 0.55
448 0.53
449 0.49
450 0.43
451 0.35
452 0.29
453 0.28
454 0.26
455 0.25
456 0.21
457 0.18
458 0.17
459 0.19
460 0.24
461 0.24
462 0.24
463 0.23
464 0.24
465 0.25
466 0.25
467 0.24
468 0.21
469 0.25
470 0.29