Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A635

Protein Details
Accession A0A4Z0A635    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
149-172LDDFTRRRRKAARKWMSRTTCRDCHydrophilic
NLS Segment(s)
PositionSequence
155-162RRRKAARK
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSPPPEGSTLTDAPEPGAQVPDSVDVLAQGPAPQAESIPPVNDDGAKIQLAQLSQAQLMELFRVLPTIVAGSKRIHIDDEAEESAPQKKRAATDSEKAGPSCKPEEASGSGTKEEDDKEEDDKEEDEEDEDEEDEFEDPELEVGSPADLDDFTRRRRKAARKWMSRTTCRDCYKTIWQDDYFEYKSGQCEDCERASFGFPSLDEMNEEVTEDESVNEELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.15
4 0.16
5 0.13
6 0.13
7 0.14
8 0.14
9 0.13
10 0.12
11 0.11
12 0.09
13 0.1
14 0.1
15 0.09
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.08
22 0.09
23 0.12
24 0.13
25 0.13
26 0.14
27 0.14
28 0.14
29 0.15
30 0.14
31 0.13
32 0.14
33 0.13
34 0.12
35 0.12
36 0.13
37 0.12
38 0.13
39 0.12
40 0.11
41 0.12
42 0.11
43 0.1
44 0.09
45 0.1
46 0.09
47 0.07
48 0.06
49 0.05
50 0.06
51 0.06
52 0.05
53 0.05
54 0.06
55 0.07
56 0.08
57 0.1
58 0.11
59 0.13
60 0.14
61 0.15
62 0.14
63 0.14
64 0.15
65 0.15
66 0.18
67 0.16
68 0.15
69 0.15
70 0.15
71 0.2
72 0.2
73 0.2
74 0.18
75 0.19
76 0.2
77 0.24
78 0.31
79 0.29
80 0.31
81 0.35
82 0.38
83 0.37
84 0.35
85 0.33
86 0.26
87 0.25
88 0.22
89 0.18
90 0.15
91 0.14
92 0.16
93 0.17
94 0.2
95 0.19
96 0.18
97 0.18
98 0.17
99 0.16
100 0.15
101 0.13
102 0.1
103 0.11
104 0.11
105 0.12
106 0.13
107 0.13
108 0.13
109 0.13
110 0.12
111 0.11
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.11
138 0.14
139 0.21
140 0.3
141 0.3
142 0.36
143 0.45
144 0.55
145 0.6
146 0.68
147 0.72
148 0.74
149 0.82
150 0.86
151 0.86
152 0.83
153 0.81
154 0.78
155 0.77
156 0.72
157 0.67
158 0.6
159 0.57
160 0.6
161 0.59
162 0.56
163 0.53
164 0.49
165 0.48
166 0.49
167 0.5
168 0.41
169 0.34
170 0.3
171 0.25
172 0.26
173 0.27
174 0.26
175 0.2
176 0.22
177 0.26
178 0.28
179 0.29
180 0.28
181 0.26
182 0.26
183 0.26
184 0.23
185 0.2
186 0.17
187 0.2
188 0.19
189 0.18
190 0.17
191 0.17
192 0.18
193 0.16
194 0.17
195 0.12
196 0.12
197 0.12
198 0.11
199 0.1
200 0.1