Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZK37

Protein Details
Accession A0A4Y9ZK37    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KIKHKRKKVKMAILKYYKVEBasic
NLS Segment(s)
PositionSequence
3-10KHKRKKVK
Subcellular Location(s) mito 12, cyto 10, nucl 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences KIKHKRKKVKMAILKYYKVESDGKIKRLRRECPSAECGAGVFMAFHQDRQYCGKCGLTYTFQPGTKPPVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.71
3 0.62
4 0.51
5 0.44
6 0.37
7 0.29
8 0.31
9 0.33
10 0.37
11 0.42
12 0.46
13 0.51
14 0.56
15 0.61
16 0.57
17 0.6
18 0.57
19 0.55
20 0.55
21 0.48
22 0.41
23 0.34
24 0.28
25 0.2
26 0.16
27 0.1
28 0.05
29 0.03
30 0.08
31 0.08
32 0.09
33 0.12
34 0.12
35 0.15
36 0.21
37 0.25
38 0.22
39 0.24
40 0.27
41 0.24
42 0.27
43 0.29
44 0.27
45 0.27
46 0.32
47 0.35
48 0.33
49 0.35
50 0.35