Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K2R7Z8

Protein Details
Accession K2R7Z8    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-37VVEKRGTCRKVRPCRKVRLYRKIRPCSKASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MDPGIRIVVEKRGTCRKVRPCRKVRLYRKIRPCSKASHTHFVCSRAIDQFDIPLRFKHQQSRIPYGQPDPAEVFNRVQSSVRILWFEEVRDMKLPPQLMDIRTHRMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.6
4 0.65
5 0.74
6 0.79
7 0.78
8 0.85
9 0.9
10 0.92
11 0.92
12 0.91
13 0.91
14 0.9
15 0.91
16 0.9
17 0.88
18 0.82
19 0.74
20 0.71
21 0.68
22 0.68
23 0.64
24 0.64
25 0.56
26 0.56
27 0.55
28 0.5
29 0.44
30 0.35
31 0.3
32 0.22
33 0.22
34 0.17
35 0.15
36 0.15
37 0.17
38 0.18
39 0.17
40 0.15
41 0.18
42 0.21
43 0.23
44 0.28
45 0.32
46 0.36
47 0.42
48 0.49
49 0.48
50 0.47
51 0.48
52 0.42
53 0.4
54 0.33
55 0.3
56 0.24
57 0.24
58 0.23
59 0.23
60 0.22
61 0.2
62 0.21
63 0.2
64 0.18
65 0.16
66 0.19
67 0.2
68 0.2
69 0.18
70 0.18
71 0.21
72 0.21
73 0.21
74 0.22
75 0.21
76 0.22
77 0.23
78 0.23
79 0.22
80 0.25
81 0.26
82 0.21
83 0.26
84 0.28
85 0.28
86 0.35
87 0.37