FuNGI

A0A4Y9ZPU1

Protein Details

Accession

A0A4Y9ZPU1

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
25-55	HTVYFQPHRPHARARRRRNRPPQERRLAAAA	Hydrophilic

NLS Segment(s)

Position	Sequence
33-50	RPHARARRRRNRPPQERR

Subcellular Location(s)

mito 14, cyto 8, extr 3

Family & Domain DBs

InterPro	View protein in InterPro IPR026891 Fn3-like IPR002772 Glyco_hydro_3_C IPR036881 Glyco_hydro_3_C_sf IPR013783 Ig-like_fold IPR037524 PA14/GLEYA
Gene Ontology	GO:0004553 F:hydrolase activity, hydrolyzing O-glycosyl compounds GO:0005975 P:carbohydrate metabolic process
Pfam	View protein in Pfam PF14310 Fn3-like PF01915 Glyco_hydro_3_C
PROSITE	View protein in PROSITE PS51820 PA14

Amino Acid Sequences

MQRARARSHIVRCSLTERLVANCTHTVYFQPHRPHARARRRRNRPPQERRLAAAAPAQEGIKTIAVLGPNAKQAFTSGGGSARLLETYSVSPLAGIKXAAEGIGATVKYAVGAMTHKYLPVLDGYVSWDGQAGAFLEFWNAEPGSAWLAGNGDSPKPDWITRTRGSYCNLMDGVDNDKVNVACWIRYRTIYTPDESGDFEFEVTMSGAGALFVNDKLVADLTQVSPADGAIFSAGSADATVVVQGLTAGSPVSVEVRSCNAEFIAKGTPWFTRGSVRVGAFRKVGKQQAIDEAVAVAKDADVAIVIVGLNHDWESEGFDRPNMSLPGASDELISAVLTANPKTIIVNQSGTPVRLLHDGPTILQAFYGGNELGNGLADVLFGVVNPSGKLALSWPKELEDNPSYGSFAEDSERYGKVLYNEGIYVGYRTYDKKNITPLFPFGYGLSYTTFEYSGLQITPIAADGTFTVSFTIKNTGAVAGREIAQVYVSDPVSSAPRPVRELKGFIKVLLEPGERKTAEVALERDALSWWDERHGVWVAEKGEFVVDVGASSRDLKLKGTVQLGETFTWTGL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.54
2	0.47
3	0.43
4	0.36
5	0.34
6	0.34
7	0.32
8	0.3
9	0.29
10	0.29
11	0.26
12	0.25
13	0.24
14	0.28
15	0.34
16	0.37
17	0.43
18	0.49
19	0.57
20	0.61
21	0.68
22	0.72
23	0.77
24	0.8
25	0.82
26	0.85
27	0.88
28	0.94
29	0.95
30	0.96
31	0.96
32	0.96
33	0.96
34	0.95
35	0.89
36	0.81
37	0.76
38	0.66
39	0.57
40	0.5
41	0.41
42	0.32
43	0.28
44	0.25
45	0.18
46	0.18
47	0.17
48	0.13
49	0.11
50	0.1
51	0.11
52	0.11
53	0.13
54	0.14
55	0.14
56	0.2
57	0.2
58	0.2
59	0.18
60	0.18
61	0.2
62	0.2
63	0.19
64	0.14
65	0.16
66	0.17
67	0.17
68	0.17
69	0.14
70	0.12
71	0.11
72	0.1
73	0.1
74	0.1
75	0.12
76	0.11
77	0.11
78	0.11
79	0.11
80	0.12
81	0.11
82	0.09
83	0.08
84	0.09
85	0.09
86	0.08
87	0.07
88	0.07
89	0.07
90	0.07
91	0.07
92	0.06
93	0.06
94	0.06
95	0.06
96	0.05
97	0.05
98	0.07
99	0.09
100	0.12
101	0.13
102	0.13
103	0.13
104	0.13
105	0.12
106	0.12
107	0.12
108	0.08
109	0.09
110	0.12
111	0.13
112	0.13
113	0.12
114	0.11
115	0.1
116	0.1
117	0.1
118	0.07
119	0.06
120	0.07
121	0.07
122	0.07
123	0.07
124	0.08
125	0.1
126	0.09
127	0.08
128	0.08
129	0.09
130	0.11
131	0.11
132	0.1
133	0.08
134	0.08
135	0.09
136	0.12
137	0.12
138	0.11
139	0.11
140	0.12
141	0.14
142	0.16
143	0.16
144	0.17
145	0.21
146	0.28
147	0.31
148	0.37
149	0.39
150	0.4
151	0.42
152	0.44
153	0.39
154	0.35
155	0.32
156	0.25
157	0.22
158	0.2
159	0.21
160	0.18
161	0.17
162	0.13
163	0.15
164	0.14
165	0.14
166	0.17
167	0.13
168	0.12
169	0.16
170	0.2
171	0.2
172	0.21
173	0.26
174	0.25
175	0.32
176	0.32
177	0.3
178	0.28
179	0.27
180	0.27
181	0.24
182	0.21
183	0.15
184	0.13
185	0.11
186	0.09
187	0.08
188	0.07
189	0.06
190	0.05
191	0.04
192	0.04
193	0.04
194	0.04
195	0.04
196	0.04
197	0.04
198	0.04
199	0.05
200	0.05
201	0.05
202	0.05
203	0.05
204	0.05
205	0.05
206	0.06
207	0.07
208	0.09
209	0.09
210	0.09
211	0.08
212	0.08
213	0.08
214	0.06
215	0.06
216	0.04
217	0.04
218	0.03
219	0.04
220	0.04
221	0.03
222	0.03
223	0.03
224	0.03
225	0.03
226	0.03
227	0.03
228	0.03
229	0.03
230	0.03
231	0.03
232	0.02
233	0.03
234	0.03
235	0.02
236	0.03
237	0.03
238	0.04
239	0.04
240	0.05
241	0.05
242	0.08
243	0.1
244	0.1
245	0.1
246	0.09
247	0.09
248	0.09
249	0.1
250	0.11
251	0.09
252	0.1
253	0.11
254	0.11
255	0.12
256	0.13
257	0.12
258	0.13
259	0.14
260	0.17
261	0.2
262	0.2
263	0.25
264	0.25
265	0.27
266	0.25
267	0.24
268	0.25
269	0.25
270	0.28
271	0.24
272	0.24
273	0.23
274	0.25
275	0.26
276	0.23
277	0.19
278	0.15
279	0.13
280	0.11
281	0.1
282	0.05
283	0.03
284	0.03
285	0.03
286	0.02
287	0.02
288	0.02
289	0.02
290	0.02
291	0.02
292	0.02
293	0.02
294	0.03
295	0.03
296	0.03
297	0.03
298	0.03
299	0.03
300	0.07
301	0.08
302	0.1
303	0.1
304	0.11
305	0.12
306	0.12
307	0.15
308	0.12
309	0.11
310	0.1
311	0.1
312	0.13
313	0.13
314	0.13
315	0.1
316	0.09
317	0.09
318	0.08
319	0.08
320	0.04
321	0.04
322	0.05
323	0.06
324	0.06
325	0.06
326	0.07
327	0.07
328	0.07
329	0.1
330	0.11
331	0.12
332	0.14
333	0.14
334	0.19
335	0.19
336	0.19
337	0.17
338	0.15
339	0.14
340	0.15
341	0.15
342	0.12
343	0.13
344	0.13
345	0.13
346	0.16
347	0.15
348	0.13
349	0.12
350	0.11
351	0.09
352	0.09
353	0.1
354	0.06
355	0.05
356	0.06
357	0.06
358	0.05
359	0.05
360	0.05
361	0.03
362	0.03
363	0.03
364	0.03
365	0.03
366	0.03
367	0.03
368	0.04
369	0.04
370	0.05
371	0.05
372	0.05
373	0.05
374	0.06
375	0.06
376	0.08
377	0.16
378	0.18
379	0.2
380	0.21
381	0.22
382	0.23
383	0.24
384	0.28
385	0.21
386	0.2
387	0.2
388	0.2
389	0.19
390	0.17
391	0.18
392	0.11
393	0.1
394	0.11
395	0.09
396	0.11
397	0.14
398	0.14
399	0.13
400	0.14
401	0.15
402	0.14
403	0.19
404	0.17
405	0.16
406	0.15
407	0.16
408	0.16
409	0.14
410	0.13
411	0.08
412	0.08
413	0.09
414	0.12
415	0.16
416	0.23
417	0.26
418	0.28
419	0.38
420	0.41
421	0.43
422	0.43
423	0.42
424	0.39
425	0.36
426	0.33
427	0.24
428	0.22
429	0.19
430	0.17
431	0.15
432	0.13
433	0.13
434	0.13
435	0.13
436	0.11
437	0.11
438	0.11
439	0.11
440	0.1
441	0.1
442	0.09
443	0.09
444	0.09
445	0.08
446	0.08
447	0.06
448	0.06
449	0.06
450	0.1
451	0.1
452	0.09
453	0.1
454	0.1
455	0.11
456	0.12
457	0.17
458	0.13
459	0.14
460	0.14
461	0.16
462	0.17
463	0.18
464	0.18
465	0.14
466	0.15
467	0.15
468	0.14
469	0.12
470	0.1
471	0.1
472	0.09
473	0.12
474	0.11
475	0.1
476	0.1
477	0.11
478	0.15
479	0.15
480	0.2
481	0.2
482	0.23
483	0.28
484	0.34
485	0.4
486	0.41
487	0.47
488	0.46
489	0.51
490	0.48
491	0.44
492	0.41
493	0.34
494	0.33
495	0.33
496	0.31
497	0.24
498	0.26
499	0.34
500	0.31
501	0.31
502	0.29
503	0.26
504	0.26
505	0.29
506	0.28
507	0.24
508	0.27
509	0.26
510	0.25
511	0.23
512	0.2
513	0.17
514	0.18
515	0.15
516	0.16
517	0.17
518	0.17
519	0.2
520	0.23
521	0.22
522	0.21
523	0.25
524	0.24
525	0.24
526	0.24
527	0.2
528	0.17
529	0.16
530	0.14
531	0.1
532	0.08
533	0.07
534	0.08
535	0.08
536	0.09
537	0.11
538	0.13
539	0.16
540	0.17
541	0.18
542	0.23
543	0.27
544	0.32
545	0.35
546	0.35
547	0.34
548	0.39
549	0.39
550	0.34
551	0.31

A0A4Y9ZPU1

3D AlphaFold-predicted Structure Viewer