Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K2QLV7

Protein Details
Accession K2QLV7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
232-253PEEGEGKKRRAGRKKRKDSNDFBasic
NLS Segment(s)
PositionSequence
236-248EGKKRRAGRKKRK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MDDPEDSYAPRSPDLSAFDNEQAEPEPLPPQHQKYRGSISHAPPQSPYAPPPNAYNPPPAGYTPPRNSIAFPTSTPMAAPHIKFEGEDGQHWSPLYSAPTTLKTETMEPGDLMDANGGMIKSEPREQAPGVAEGIEVKTKFPAARIKRIMQADEDVGKVAQVTPHVVAKALELFMISLVTKAAAEAKNRSSKRVSAAHLKQAVLQDEHFDFLNDIVNKVSDAPAPADRGGSPEEGEGKKRRAGRKKRKDSNDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.26
4 0.28
5 0.3
6 0.3
7 0.29
8 0.26
9 0.23
10 0.2
11 0.18
12 0.16
13 0.18
14 0.17
15 0.23
16 0.29
17 0.34
18 0.42
19 0.48
20 0.51
21 0.52
22 0.6
23 0.58
24 0.59
25 0.6
26 0.56
27 0.59
28 0.57
29 0.52
30 0.44
31 0.45
32 0.4
33 0.34
34 0.33
35 0.32
36 0.31
37 0.32
38 0.35
39 0.39
40 0.41
41 0.41
42 0.42
43 0.36
44 0.35
45 0.36
46 0.32
47 0.31
48 0.32
49 0.38
50 0.37
51 0.4
52 0.42
53 0.4
54 0.41
55 0.39
56 0.36
57 0.3
58 0.26
59 0.24
60 0.21
61 0.2
62 0.19
63 0.15
64 0.16
65 0.18
66 0.18
67 0.17
68 0.17
69 0.18
70 0.17
71 0.18
72 0.2
73 0.17
74 0.18
75 0.21
76 0.2
77 0.21
78 0.21
79 0.19
80 0.14
81 0.14
82 0.15
83 0.09
84 0.1
85 0.11
86 0.14
87 0.16
88 0.17
89 0.16
90 0.15
91 0.16
92 0.17
93 0.17
94 0.14
95 0.11
96 0.11
97 0.1
98 0.09
99 0.08
100 0.06
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.06
109 0.09
110 0.1
111 0.1
112 0.12
113 0.12
114 0.15
115 0.16
116 0.15
117 0.12
118 0.11
119 0.1
120 0.08
121 0.09
122 0.08
123 0.07
124 0.06
125 0.07
126 0.08
127 0.08
128 0.11
129 0.19
130 0.22
131 0.31
132 0.36
133 0.38
134 0.43
135 0.45
136 0.43
137 0.35
138 0.32
139 0.25
140 0.22
141 0.19
142 0.14
143 0.12
144 0.1
145 0.09
146 0.08
147 0.07
148 0.06
149 0.07
150 0.08
151 0.1
152 0.1
153 0.1
154 0.1
155 0.1
156 0.11
157 0.09
158 0.08
159 0.07
160 0.07
161 0.06
162 0.07
163 0.06
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.1
170 0.12
171 0.15
172 0.19
173 0.25
174 0.34
175 0.35
176 0.39
177 0.37
178 0.37
179 0.41
180 0.44
181 0.42
182 0.44
183 0.48
184 0.53
185 0.54
186 0.51
187 0.47
188 0.44
189 0.43
190 0.34
191 0.29
192 0.24
193 0.21
194 0.22
195 0.19
196 0.15
197 0.12
198 0.11
199 0.18
200 0.15
201 0.15
202 0.14
203 0.15
204 0.14
205 0.15
206 0.16
207 0.1
208 0.12
209 0.15
210 0.17
211 0.2
212 0.2
213 0.2
214 0.19
215 0.2
216 0.21
217 0.19
218 0.17
219 0.16
220 0.22
221 0.23
222 0.3
223 0.34
224 0.35
225 0.39
226 0.46
227 0.54
228 0.59
229 0.68
230 0.73
231 0.78
232 0.86
233 0.91