Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZMB9

Protein Details
Accession A0A4Y9ZMB9   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MHPHSRWVQRKKSFKLKLEGIPNSSMIRRRRHKRHADSAGANHydrophilic
NLS Segment(s)
PositionSequence
26-34MIRRRRHKR
Subcellular Location(s) mito 13.5mito_nucl 13.5, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MHPHSRWVQRKKSFKLKLEGIPNSSMIRRRRHKRHADSAGANAAETGTRLLELFGQLMEARMESCHRINRLVKDANRADLMSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.78
4 0.75
5 0.75
6 0.69
7 0.62
8 0.54
9 0.48
10 0.41
11 0.37
12 0.36
13 0.32
14 0.38
15 0.44
16 0.53
17 0.61
18 0.7
19 0.78
20 0.81
21 0.85
22 0.84
23 0.81
24 0.73
25 0.65
26 0.57
27 0.46
28 0.36
29 0.25
30 0.17
31 0.1
32 0.08
33 0.06
34 0.03
35 0.03
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.08
50 0.11
51 0.15
52 0.2
53 0.22
54 0.29
55 0.35
56 0.4
57 0.47
58 0.53
59 0.52
60 0.56
61 0.57
62 0.55
63 0.51