Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N3G4

Protein Details
Accession G9N3G4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRKANRKKLKAKAKKEWNPATYFHydrophilic
NLS Segment(s)
PositionSequence
3-15KANRKKLKAKAKK
Subcellular Location(s) mito 13.5, cyto_mito 7.5, E.R. 4, golg 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035213  DUF5321  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF17254  DUF5321  
Amino Acid Sequences MRKANRKKLKAKAKKEWNPATYFIVMFLFIGSMSIQMIALRNQTERYMRQSALRIAQLREVVRRIQNGEDVDVEKVLGTGDAQKETEWEEVLQAIERDEASRGLEKQPKQEQTGAQAKTTSQPESSAQQVQPEAPVKTKTASFGNFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.91
4 0.85
5 0.78
6 0.71
7 0.65
8 0.55
9 0.46
10 0.36
11 0.26
12 0.21
13 0.16
14 0.13
15 0.08
16 0.05
17 0.06
18 0.05
19 0.04
20 0.04
21 0.05
22 0.05
23 0.05
24 0.07
25 0.07
26 0.09
27 0.1
28 0.11
29 0.12
30 0.15
31 0.18
32 0.19
33 0.25
34 0.27
35 0.26
36 0.29
37 0.32
38 0.32
39 0.32
40 0.34
41 0.3
42 0.27
43 0.29
44 0.29
45 0.26
46 0.25
47 0.23
48 0.22
49 0.22
50 0.23
51 0.22
52 0.19
53 0.22
54 0.2
55 0.19
56 0.17
57 0.16
58 0.14
59 0.12
60 0.11
61 0.07
62 0.06
63 0.05
64 0.04
65 0.03
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.11
73 0.12
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.07
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.07
87 0.09
88 0.11
89 0.12
90 0.18
91 0.25
92 0.27
93 0.35
94 0.42
95 0.45
96 0.46
97 0.49
98 0.44
99 0.46
100 0.52
101 0.45
102 0.38
103 0.34
104 0.31
105 0.33
106 0.34
107 0.28
108 0.2
109 0.21
110 0.23
111 0.25
112 0.29
113 0.29
114 0.27
115 0.29
116 0.29
117 0.27
118 0.3
119 0.32
120 0.29
121 0.27
122 0.29
123 0.27
124 0.29
125 0.29
126 0.27
127 0.29