Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZPA6

Protein Details
Accession A0A4Y9ZPA6   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26ARVKPLSFGKKQKQRKPERGEEENTRBasic
NLS Segment(s)
PositionSequence
10-17KKQKQRKP
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences ARVKPLSFGKKQKQRKPERGEEENTRGDGENAAPVNKETGARKRLRSFKLARTDTTKERAALRAKEVLPDVVVRPPSQSQHTGYAAYTFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.88
5 0.87
6 0.84
7 0.82
8 0.79
9 0.74
10 0.66
11 0.57
12 0.47
13 0.38
14 0.31
15 0.25
16 0.17
17 0.15
18 0.13
19 0.12
20 0.11
21 0.11
22 0.12
23 0.11
24 0.13
25 0.12
26 0.19
27 0.26
28 0.3
29 0.34
30 0.4
31 0.48
32 0.49
33 0.54
34 0.52
35 0.52
36 0.59
37 0.57
38 0.52
39 0.5
40 0.52
41 0.48
42 0.48
43 0.42
44 0.33
45 0.33
46 0.37
47 0.36
48 0.34
49 0.33
50 0.35
51 0.33
52 0.34
53 0.33
54 0.28
55 0.23
56 0.22
57 0.2
58 0.17
59 0.19
60 0.16
61 0.19
62 0.21
63 0.24
64 0.27
65 0.3
66 0.29
67 0.34
68 0.36
69 0.34
70 0.31