Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZZL3

Protein Details
Accession A0A4Y9ZZL3   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-97YHRPRRWCLASTRRRRSRGCMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045090  Pept_M3A_M3B  
IPR001567  Pept_M3A_M3B_dom  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF01432  Peptidase_M3  
Amino Acid Sequences MIGRTEYQNVCGTRCATDFVELPSILMEHFLNSPTVLSLFDSGDKSAIRQVGNHHEDPCHNIDTHGQIMLAVLDQIYHRPRRWCLASTRRRRSRGCMPSAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.21
4 0.23
5 0.22
6 0.21
7 0.24
8 0.21
9 0.2
10 0.16
11 0.15
12 0.12
13 0.12
14 0.09
15 0.06
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.06
24 0.06
25 0.07
26 0.07
27 0.09
28 0.09
29 0.09
30 0.1
31 0.09
32 0.09
33 0.1
34 0.12
35 0.11
36 0.11
37 0.14
38 0.22
39 0.27
40 0.28
41 0.26
42 0.25
43 0.25
44 0.28
45 0.28
46 0.2
47 0.16
48 0.15
49 0.16
50 0.18
51 0.18
52 0.15
53 0.12
54 0.1
55 0.1
56 0.09
57 0.08
58 0.05
59 0.04
60 0.04
61 0.04
62 0.08
63 0.14
64 0.18
65 0.22
66 0.27
67 0.31
68 0.38
69 0.43
70 0.44
71 0.49
72 0.56
73 0.63
74 0.69
75 0.77
76 0.79
77 0.82
78 0.82
79 0.79
80 0.79
81 0.79