Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZYN6

Protein Details
Accession A0A4Y9ZYN6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-48LSHCRSQSTTNPAKRKKRKRADSGSEEAGHydrophilic
NLS Segment(s)
PositionSequence
32-40AKRKKRKRA
Subcellular Location(s) nucl 23, cyto_nucl 13.333, mito_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MIHKELELALEQHGIHPSHLSHCRSQSTTNPAKRKKRKRADSGSEEAGTELPQSPSKRGMSGPKGAKSSVLDTTEDTREPSSKRIKQMSTGKQAVNDVVSMVTQAGDNQAVFVGKEQKEKEVLRDPVYLEWVETIQKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.17
4 0.17
5 0.22
6 0.3
7 0.32
8 0.32
9 0.36
10 0.41
11 0.41
12 0.44
13 0.44
14 0.46
15 0.52
16 0.56
17 0.62
18 0.66
19 0.75
20 0.82
21 0.86
22 0.87
23 0.89
24 0.9
25 0.91
26 0.93
27 0.92
28 0.89
29 0.83
30 0.76
31 0.65
32 0.55
33 0.44
34 0.33
35 0.23
36 0.16
37 0.12
38 0.09
39 0.13
40 0.14
41 0.15
42 0.19
43 0.2
44 0.2
45 0.21
46 0.28
47 0.28
48 0.35
49 0.38
50 0.37
51 0.38
52 0.36
53 0.35
54 0.29
55 0.27
56 0.22
57 0.19
58 0.15
59 0.15
60 0.18
61 0.18
62 0.17
63 0.15
64 0.13
65 0.14
66 0.15
67 0.2
68 0.27
69 0.31
70 0.37
71 0.42
72 0.43
73 0.49
74 0.57
75 0.6
76 0.59
77 0.59
78 0.53
79 0.48
80 0.48
81 0.4
82 0.31
83 0.22
84 0.13
85 0.09
86 0.08
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.1
100 0.17
101 0.18
102 0.25
103 0.26
104 0.28
105 0.35
106 0.36
107 0.4
108 0.42
109 0.45
110 0.42
111 0.44
112 0.43
113 0.38
114 0.4
115 0.34
116 0.24
117 0.21
118 0.18