Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZN52

Protein Details
Accession A0A4Y9ZN52    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-26GSTSKGRILGHKRGKRNTRPNTSLLHydrophilic
NLS Segment(s)
PositionSequence
13-16KRGK
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTSKGRILGHKRGKRNTRPNTSLLQIEGVASKEDAQFYLGKRVAYVYRAKKEIHGSKVRVIWGRVTRSHGGSGAVKSKFRSNLPPSSFGATVRIMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.82
3 0.83
4 0.86
5 0.86
6 0.86
7 0.82
8 0.77
9 0.71
10 0.64
11 0.55
12 0.44
13 0.35
14 0.25
15 0.2
16 0.18
17 0.13
18 0.11
19 0.09
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.11
27 0.18
28 0.19
29 0.18
30 0.18
31 0.19
32 0.19
33 0.2
34 0.26
35 0.26
36 0.28
37 0.3
38 0.31
39 0.32
40 0.39
41 0.42
42 0.42
43 0.42
44 0.41
45 0.43
46 0.45
47 0.45
48 0.4
49 0.34
50 0.33
51 0.32
52 0.34
53 0.32
54 0.35
55 0.34
56 0.33
57 0.33
58 0.28
59 0.24
60 0.23
61 0.24
62 0.25
63 0.25
64 0.25
65 0.25
66 0.3
67 0.32
68 0.32
69 0.39
70 0.39
71 0.47
72 0.5
73 0.53
74 0.5
75 0.5
76 0.48
77 0.39
78 0.36
79 0.27
80 0.24
81 0.2
82 0.18
83 0.14