Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A8Q1

Protein Details
Accession A0A4Z0A8Q1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
302-323EGSQEKGKKRGRPKAAEKAAEKBasic
NLS Segment(s)
PositionSequence
304-324SQEKGKKRGRPKAAEKAAEKT
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038014  Ies1  
Gene Ontology GO:0031011  C:Ino80 complex  
Amino Acid Sequences MASQKATTSLYARRKTFAIKHEEAEPLTRRDIQYDFLSFVFGDTHRVFTDPFAPVRDGADSPKITFRDLYVHTIIQSSRCSRALRDKMVDSAGFATDFAKISLLANVGRVNTTMTFLPEMRTSLRTYHPVPSLQKTDGNLQDAPRIKNILKACTLKTEADGVPVTPAEMATRAAQGTIPSTSIVNMLFVLSNHFTAIARDHFGRTDIDFLDLFLPINLSSASRANAFLWLIYHYHEAPSANPFDDDYSRANEGMAPKLVDLTPEEMALENVDTQEEKDFGIKMSQFRLDFLSKNAQNPKPGEGSQEKGKKRGRPKAAEKAAEKTVKRQHSEMETIPQEADIDVEEREPRRRRLSYTQQGESHDNFSHAPLGFSTPVVLTPDFPPRYRIPLDGRIDIGPQRTIVQQAWHVVSTVDPLADDDDEGIDEHSRYDYGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.57
4 0.56
5 0.56
6 0.52
7 0.53
8 0.54
9 0.56
10 0.49
11 0.48
12 0.44
13 0.38
14 0.37
15 0.4
16 0.35
17 0.35
18 0.35
19 0.32
20 0.33
21 0.31
22 0.3
23 0.24
24 0.25
25 0.21
26 0.2
27 0.18
28 0.13
29 0.18
30 0.16
31 0.19
32 0.18
33 0.2
34 0.2
35 0.19
36 0.25
37 0.22
38 0.23
39 0.24
40 0.25
41 0.24
42 0.25
43 0.26
44 0.21
45 0.21
46 0.27
47 0.25
48 0.26
49 0.31
50 0.31
51 0.29
52 0.29
53 0.26
54 0.26
55 0.28
56 0.32
57 0.29
58 0.28
59 0.27
60 0.29
61 0.29
62 0.24
63 0.27
64 0.24
65 0.25
66 0.29
67 0.3
68 0.31
69 0.41
70 0.47
71 0.49
72 0.52
73 0.49
74 0.48
75 0.5
76 0.45
77 0.36
78 0.29
79 0.22
80 0.16
81 0.14
82 0.12
83 0.1
84 0.11
85 0.09
86 0.08
87 0.08
88 0.08
89 0.1
90 0.11
91 0.09
92 0.11
93 0.12
94 0.12
95 0.12
96 0.12
97 0.12
98 0.11
99 0.12
100 0.11
101 0.11
102 0.13
103 0.13
104 0.15
105 0.14
106 0.15
107 0.16
108 0.17
109 0.17
110 0.19
111 0.22
112 0.25
113 0.27
114 0.31
115 0.32
116 0.35
117 0.38
118 0.4
119 0.4
120 0.38
121 0.38
122 0.34
123 0.37
124 0.35
125 0.34
126 0.31
127 0.27
128 0.31
129 0.33
130 0.33
131 0.28
132 0.28
133 0.25
134 0.29
135 0.31
136 0.29
137 0.3
138 0.32
139 0.31
140 0.33
141 0.35
142 0.29
143 0.28
144 0.28
145 0.22
146 0.22
147 0.21
148 0.16
149 0.14
150 0.13
151 0.12
152 0.08
153 0.08
154 0.05
155 0.06
156 0.07
157 0.07
158 0.08
159 0.07
160 0.08
161 0.08
162 0.08
163 0.09
164 0.08
165 0.08
166 0.07
167 0.07
168 0.08
169 0.08
170 0.08
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.08
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.1
184 0.09
185 0.1
186 0.1
187 0.11
188 0.11
189 0.12
190 0.13
191 0.11
192 0.12
193 0.11
194 0.11
195 0.11
196 0.11
197 0.1
198 0.09
199 0.09
200 0.06
201 0.06
202 0.04
203 0.05
204 0.05
205 0.04
206 0.05
207 0.06
208 0.07
209 0.07
210 0.08
211 0.08
212 0.09
213 0.09
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.1
220 0.09
221 0.09
222 0.1
223 0.1
224 0.1
225 0.12
226 0.12
227 0.11
228 0.11
229 0.11
230 0.11
231 0.12
232 0.13
233 0.12
234 0.14
235 0.14
236 0.14
237 0.14
238 0.14
239 0.15
240 0.15
241 0.14
242 0.12
243 0.11
244 0.12
245 0.12
246 0.1
247 0.1
248 0.1
249 0.1
250 0.09
251 0.1
252 0.09
253 0.09
254 0.08
255 0.07
256 0.05
257 0.05
258 0.05
259 0.05
260 0.05
261 0.06
262 0.07
263 0.07
264 0.08
265 0.08
266 0.08
267 0.12
268 0.14
269 0.14
270 0.17
271 0.21
272 0.19
273 0.2
274 0.24
275 0.22
276 0.21
277 0.23
278 0.3
279 0.27
280 0.33
281 0.41
282 0.39
283 0.42
284 0.43
285 0.44
286 0.39
287 0.37
288 0.38
289 0.33
290 0.35
291 0.38
292 0.45
293 0.43
294 0.47
295 0.53
296 0.55
297 0.61
298 0.67
299 0.68
300 0.7
301 0.78
302 0.8
303 0.83
304 0.82
305 0.75
306 0.7
307 0.67
308 0.64
309 0.55
310 0.52
311 0.52
312 0.52
313 0.52
314 0.49
315 0.47
316 0.46
317 0.5
318 0.44
319 0.43
320 0.37
321 0.35
322 0.34
323 0.28
324 0.22
325 0.17
326 0.15
327 0.08
328 0.08
329 0.07
330 0.08
331 0.12
332 0.14
333 0.23
334 0.29
335 0.34
336 0.42
337 0.46
338 0.51
339 0.58
340 0.67
341 0.69
342 0.71
343 0.72
344 0.67
345 0.68
346 0.66
347 0.58
348 0.51
349 0.42
350 0.35
351 0.28
352 0.25
353 0.26
354 0.21
355 0.19
356 0.16
357 0.19
358 0.18
359 0.17
360 0.17
361 0.12
362 0.13
363 0.16
364 0.15
365 0.13
366 0.16
367 0.26
368 0.28
369 0.28
370 0.32
371 0.32
372 0.39
373 0.39
374 0.42
375 0.4
376 0.47
377 0.51
378 0.49
379 0.48
380 0.43
381 0.43
382 0.4
383 0.36
384 0.27
385 0.23
386 0.22
387 0.21
388 0.24
389 0.22
390 0.23
391 0.24
392 0.28
393 0.3
394 0.28
395 0.27
396 0.24
397 0.22
398 0.21
399 0.18
400 0.13
401 0.1
402 0.11
403 0.13
404 0.13
405 0.12
406 0.1
407 0.09
408 0.1
409 0.1
410 0.1
411 0.1
412 0.1
413 0.1
414 0.11