FuNGI

A0A4Z0A8Q1

Protein Details

Accession

A0A4Z0A8Q1

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
302-323	EGSQEKGKKRGRPKAAEKAAEK	Basic

NLS Segment(s)

Position	Sequence
304-324	SQEKGKKRGRPKAAEKAAEKT

Subcellular Location(s)

nucl 14, cyto_nucl 11.5, cyto 7, mito 6

Family & Domain DBs

InterPro	View protein in InterPro IPR038014 Ies1
Gene Ontology	GO:0031011 C:Ino80 complex

Amino Acid Sequences

MASQKATTSLYARRKTFAIKHEEAEPLTRRDIQYDFLSFVFGDTHRVFTDPFAPVRDGADSPKITFRDLYVHTIIQSSRCSRALRDKMVDSAGFATDFAKISLLANVGRVNTTMTFLPEMRTSLRTYHPVPSLQKTDGNLQDAPRIKNILKACTLKTEADGVPVTPAEMATRAAQGTIPSTSIVNMLFVLSNHFTAIARDHFGRTDIDFLDLFLPINLSSASRANAFLWLIYHYHEAPSANPFDDDYSRANEGMAPKLVDLTPEEMALENVDTQEEKDFGIKMSQFRLDFLSKNAQNPKPGEGSQEKGKKRGRPKAAEKAAEKTVKRQHSEMETIPQEADIDVEEREPRRRRLSYTQQGESHDNFSHAPLGFSTPVVLTPDFPPRYRIPLDGRIDIGPQRTIVQQAWHVVSTVDPLADDDDEGIDEHSRYDYGK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.54
3	0.57
4	0.56
5	0.56
6	0.52
7	0.53
8	0.54
9	0.56
10	0.49
11	0.48
12	0.44
13	0.38
14	0.37
15	0.4
16	0.35
17	0.35
18	0.35
19	0.32
20	0.33
21	0.31
22	0.3
23	0.24
24	0.25
25	0.21
26	0.2
27	0.18
28	0.13
29	0.18
30	0.16
31	0.19
32	0.18
33	0.2
34	0.2
35	0.19
36	0.25
37	0.22
38	0.23
39	0.24
40	0.25
41	0.24
42	0.25
43	0.26
44	0.21
45	0.21
46	0.27
47	0.25
48	0.26
49	0.31
50	0.31
51	0.29
52	0.29
53	0.26
54	0.26
55	0.28
56	0.32
57	0.29
58	0.28
59	0.27
60	0.29
61	0.29
62	0.24
63	0.27
64	0.24
65	0.25
66	0.29
67	0.3
68	0.31
69	0.41
70	0.47
71	0.49
72	0.52
73	0.49
74	0.48
75	0.5
76	0.45
77	0.36
78	0.29
79	0.22
80	0.16
81	0.14
82	0.12
83	0.1
84	0.11
85	0.09
86	0.08
87	0.08
88	0.08
89	0.1
90	0.11
91	0.09
92	0.11
93	0.12
94	0.12
95	0.12
96	0.12
97	0.12
98	0.11
99	0.12
100	0.11
101	0.11
102	0.13
103	0.13
104	0.15
105	0.14
106	0.15
107	0.16
108	0.17
109	0.17
110	0.19
111	0.22
112	0.25
113	0.27
114	0.31
115	0.32
116	0.35
117	0.38
118	0.4
119	0.4
120	0.38
121	0.38
122	0.34
123	0.37
124	0.35
125	0.34
126	0.31
127	0.27
128	0.31
129	0.33
130	0.33
131	0.28
132	0.28
133	0.25
134	0.29
135	0.31
136	0.29
137	0.3
138	0.32
139	0.31
140	0.33
141	0.35
142	0.29
143	0.28
144	0.28
145	0.22
146	0.22
147	0.21
148	0.16
149	0.14
150	0.13
151	0.12
152	0.08
153	0.08
154	0.05
155	0.06
156	0.07
157	0.07
158	0.08
159	0.07
160	0.08
161	0.08
162	0.08
163	0.09
164	0.08
165	0.08
166	0.07
167	0.07
168	0.08
169	0.08
170	0.08
171	0.06
172	0.06
173	0.06
174	0.06
175	0.06
176	0.08
177	0.08
178	0.08
179	0.08
180	0.08
181	0.08
182	0.08
183	0.1
184	0.09
185	0.1
186	0.1
187	0.11
188	0.11
189	0.12
190	0.13
191	0.11
192	0.12
193	0.11
194	0.11
195	0.11
196	0.11
197	0.1
198	0.09
199	0.09
200	0.06
201	0.06
202	0.04
203	0.05
204	0.05
205	0.04
206	0.05
207	0.06
208	0.07
209	0.07
210	0.08
211	0.08
212	0.09
213	0.09
214	0.08
215	0.08
216	0.08
217	0.08
218	0.08
219	0.1
220	0.09
221	0.09
222	0.1
223	0.1
224	0.1
225	0.12
226	0.12
227	0.11
228	0.11
229	0.11
230	0.11
231	0.12
232	0.13
233	0.12
234	0.14
235	0.14
236	0.14
237	0.14
238	0.14
239	0.15
240	0.15
241	0.14
242	0.12
243	0.11
244	0.12
245	0.12
246	0.1
247	0.1
248	0.1
249	0.1
250	0.09
251	0.1
252	0.09
253	0.09
254	0.08
255	0.07
256	0.05
257	0.05
258	0.05
259	0.05
260	0.05
261	0.06
262	0.07
263	0.07
264	0.08
265	0.08
266	0.08
267	0.12
268	0.14
269	0.14
270	0.17
271	0.21
272	0.19
273	0.2
274	0.24
275	0.22
276	0.21
277	0.23
278	0.3
279	0.27
280	0.33
281	0.41
282	0.39
283	0.42
284	0.43
285	0.44
286	0.39
287	0.37
288	0.38
289	0.33
290	0.35
291	0.38
292	0.45
293	0.43
294	0.47
295	0.53
296	0.55
297	0.61
298	0.67
299	0.68
300	0.7
301	0.78
302	0.8
303	0.83
304	0.82
305	0.75
306	0.7
307	0.67
308	0.64
309	0.55
310	0.52
311	0.52
312	0.52
313	0.52
314	0.49
315	0.47
316	0.46
317	0.5
318	0.44
319	0.43
320	0.37
321	0.35
322	0.34
323	0.28
324	0.22
325	0.17
326	0.15
327	0.08
328	0.08
329	0.07
330	0.08
331	0.12
332	0.14
333	0.23
334	0.29
335	0.34
336	0.42
337	0.46
338	0.51
339	0.58
340	0.67
341	0.69
342	0.71
343	0.72
344	0.67
345	0.68
346	0.66
347	0.58
348	0.51
349	0.42
350	0.35
351	0.28
352	0.25
353	0.26
354	0.21
355	0.19
356	0.16
357	0.19
358	0.18
359	0.17
360	0.17
361	0.12
362	0.13
363	0.16
364	0.15
365	0.13
366	0.16
367	0.26
368	0.28
369	0.28
370	0.32
371	0.32
372	0.39
373	0.39
374	0.42
375	0.4
376	0.47
377	0.51
378	0.49
379	0.48
380	0.43
381	0.43
382	0.4
383	0.36
384	0.27
385	0.23
386	0.22
387	0.21
388	0.24
389	0.22
390	0.23
391	0.24
392	0.28
393	0.3
394	0.28
395	0.27
396	0.24
397	0.22
398	0.21
399	0.18
400	0.13
401	0.1
402	0.11
403	0.13
404	0.13
405	0.12
406	0.1
407	0.09
408	0.1
409	0.1
410	0.1
411	0.1
412	0.1
413	0.1
414	0.11

A0A4Z0A8Q1

3D AlphaFold-predicted Structure Viewer