Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0A5S4

Protein Details
Accession A0A4Z0A5S4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
9-32NPSPETEKRRHKLKRLVQSPNSYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000592  Ribosomal_S27  
IPR023407  Ribosomal_S27_Zn-bd_dom_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01667  Ribosomal_S27e  
PROSITE View protein in PROSITE  
PS01168  RIBOSOMAL_S27E  
Amino Acid Sequences MTLAVDLLNPSPETEKRRHKLKRLVQSPNSYFMDVKCPGCFAITTVFSHAQTVVICASCASVLCQPTGGKARLTEGSSYRRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.41
3 0.46
4 0.56
5 0.64
6 0.69
7 0.76
8 0.8
9 0.82
10 0.81
11 0.84
12 0.81
13 0.82
14 0.74
15 0.7
16 0.62
17 0.52
18 0.43
19 0.34
20 0.33
21 0.26
22 0.25
23 0.18
24 0.17
25 0.16
26 0.16
27 0.15
28 0.09
29 0.1
30 0.1
31 0.11
32 0.13
33 0.14
34 0.14
35 0.14
36 0.13
37 0.11
38 0.1
39 0.1
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.07
48 0.1
49 0.11
50 0.11
51 0.13
52 0.13
53 0.18
54 0.24
55 0.23
56 0.21
57 0.22
58 0.25
59 0.28
60 0.3
61 0.29
62 0.29
63 0.36