Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZZA6

Protein Details
Accession A0A4Y9ZZA6   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22GRERMMEKKREKREGDRSFRERBasic
NLS Segment(s)
PositionSequence
10-10R
52-61ARKRFEEKRG
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences GRERMMEKKREKREGDRSFRERGDEGFVEADESTLMGGGDSFKEQIARRDAARKRFEEKRGASREDKTSVVRERAEALREKEKATMDMFMQMAKQKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.78
5 0.75
6 0.69
7 0.63
8 0.53
9 0.44
10 0.4
11 0.31
12 0.27
13 0.22
14 0.2
15 0.17
16 0.16
17 0.14
18 0.07
19 0.07
20 0.05
21 0.04
22 0.04
23 0.03
24 0.03
25 0.03
26 0.04
27 0.04
28 0.05
29 0.05
30 0.08
31 0.09
32 0.13
33 0.17
34 0.17
35 0.18
36 0.27
37 0.31
38 0.38
39 0.43
40 0.41
41 0.43
42 0.49
43 0.53
44 0.53
45 0.53
46 0.54
47 0.55
48 0.57
49 0.55
50 0.52
51 0.52
52 0.45
53 0.43
54 0.35
55 0.36
56 0.36
57 0.37
58 0.33
59 0.29
60 0.31
61 0.32
62 0.33
63 0.33
64 0.33
65 0.37
66 0.38
67 0.38
68 0.37
69 0.36
70 0.35
71 0.3
72 0.28
73 0.21
74 0.23
75 0.22
76 0.19
77 0.2
78 0.23