Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZXQ8

Protein Details
Accession A0A4Y9ZXQ8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-43MWCIEYRKTRKARRVQAKAQQAGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 7, plas 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRTGAAVGGLVGLAALILFCMWCIEYRKTRKARRVQAKAQQAGLENASELRPMNVQPPAQLATSHAGYAHGNGDYASARSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.03
9 0.06
10 0.11
11 0.16
12 0.25
13 0.33
14 0.43
15 0.52
16 0.59
17 0.66
18 0.72
19 0.77
20 0.79
21 0.81
22 0.8
23 0.79
24 0.8
25 0.73
26 0.64
27 0.55
28 0.45
29 0.37
30 0.29
31 0.2
32 0.11
33 0.1
34 0.09
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.11
41 0.14
42 0.14
43 0.14
44 0.17
45 0.18
46 0.18
47 0.17
48 0.16
49 0.16
50 0.17
51 0.16
52 0.14
53 0.13
54 0.13
55 0.14
56 0.14
57 0.1
58 0.1
59 0.1
60 0.11
61 0.11