Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NB93

Protein Details
Accession G9NB93    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPNKPRELKRPRKHKPTRHKIRKIREIRVPLSBasic
NLS Segment(s)
PositionSequence
4-39KPRELKRPRKHKPTRHKIRKIREIRVPLSRPKRMWK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036265  HIT-like_sf  
Amino Acid Sequences MPNKPRELKRPRKHKPTRHKIRKIREIRVPLSRPKRMWKHVRDIESLNYSHYGLLCEMDAVKHYILKKYCPHIPLSEVHSGYHRGRRPLIGSIYYPDIISVHHLHLHVIVRPQWRRKWLRYALPLMWKSDEKVLLKVKEQASKRKKLLSALDHARCERLEEEIERLKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.94
4 0.95
5 0.95
6 0.96
7 0.95
8 0.95
9 0.95
10 0.93
11 0.9
12 0.88
13 0.85
14 0.79
15 0.79
16 0.73
17 0.72
18 0.72
19 0.71
20 0.65
21 0.67
22 0.71
23 0.71
24 0.76
25 0.74
26 0.75
27 0.76
28 0.77
29 0.7
30 0.64
31 0.59
32 0.52
33 0.45
34 0.35
35 0.29
36 0.24
37 0.2
38 0.17
39 0.13
40 0.09
41 0.1
42 0.08
43 0.07
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.09
50 0.11
51 0.16
52 0.17
53 0.21
54 0.25
55 0.28
56 0.33
57 0.32
58 0.33
59 0.29
60 0.3
61 0.29
62 0.29
63 0.29
64 0.25
65 0.24
66 0.23
67 0.25
68 0.24
69 0.28
70 0.26
71 0.23
72 0.23
73 0.25
74 0.26
75 0.26
76 0.27
77 0.22
78 0.2
79 0.19
80 0.2
81 0.19
82 0.17
83 0.12
84 0.1
85 0.08
86 0.11
87 0.11
88 0.1
89 0.12
90 0.12
91 0.12
92 0.14
93 0.16
94 0.14
95 0.15
96 0.19
97 0.24
98 0.3
99 0.37
100 0.39
101 0.47
102 0.53
103 0.56
104 0.62
105 0.63
106 0.66
107 0.67
108 0.68
109 0.64
110 0.65
111 0.61
112 0.53
113 0.49
114 0.4
115 0.35
116 0.33
117 0.33
118 0.26
119 0.3
120 0.35
121 0.34
122 0.36
123 0.42
124 0.42
125 0.43
126 0.47
127 0.52
128 0.54
129 0.61
130 0.63
131 0.64
132 0.62
133 0.62
134 0.66
135 0.62
136 0.63
137 0.63
138 0.65
139 0.62
140 0.6
141 0.55
142 0.46
143 0.43
144 0.34
145 0.28
146 0.27
147 0.24
148 0.3