Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0A8M7

Protein Details
Accession A0A4Z0A8M7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKRKKSSRKPAPTRRKDPLVKVDRKBasic
NLS Segment(s)
PositionSequence
3-19KRKKSSRKPAPTRRKDP
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPAPTRRKDPLVKVDRKEGLAQLVCRVCDQRYQSKVNHLTEPIDIYSEWIDAADAAEKGDRVQRRPAASSSRPRPAAPSVPSDDEDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.91
3 0.89
4 0.85
5 0.82
6 0.82
7 0.81
8 0.78
9 0.73
10 0.72
11 0.65
12 0.6
13 0.53
14 0.43
15 0.39
16 0.33
17 0.31
18 0.28
19 0.26
20 0.25
21 0.24
22 0.24
23 0.18
24 0.2
25 0.24
26 0.27
27 0.31
28 0.35
29 0.36
30 0.43
31 0.49
32 0.46
33 0.44
34 0.36
35 0.32
36 0.28
37 0.28
38 0.19
39 0.13
40 0.1
41 0.09
42 0.09
43 0.07
44 0.07
45 0.05
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.12
56 0.15
57 0.17
58 0.25
59 0.29
60 0.33
61 0.36
62 0.4
63 0.44
64 0.48
65 0.56
66 0.56
67 0.6
68 0.58
69 0.55
70 0.56
71 0.53
72 0.54
73 0.47
74 0.46
75 0.43
76 0.45
77 0.46
78 0.44