Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A8X4

Protein Details
Accession A0A4Z0A8X4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRAKKKEVKEKQRVKQQQLELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences MRAKKKEVKEKQRVKQQQLELSIAQGTEADSLVPDPDLSSTINARPVCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.79
4 0.74
5 0.67
6 0.61
7 0.49
8 0.41
9 0.33
10 0.24
11 0.18
12 0.11
13 0.08
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.05
20 0.05
21 0.04
22 0.04
23 0.05
24 0.06
25 0.07
26 0.09
27 0.12
28 0.14
29 0.21