Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A5G6

Protein Details
Accession A0A4Z0A5G6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-40ASLPRMKDGRRPPKHVEGVSHydrophilic
NLS Segment(s)
PositionSequence
24-32PRMKDGRRP
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 9.5, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEQPSAAEQRAFAVTKLKRAASLPRMKDGRRPPKHVEGVSEGEKSPEEQEEAGENERYVDDEGQEEIGETVEEMVQVVEHQQEESVRKAEDVDEESVASPLATPLPSEDATVPKPNDVRVHAREDELMGSPXPSXDYENGMERRGVVVEDDDIPERMSPPRPSFSGLPPSTPPRVAALRVPHGSDAPSSMSTDSGVGVPVYLSETIHRHHDMFPSSPFATPLREKSGPEDDDDDMDMFHGNGDVSRLSPLNSGYEREISWVAVRDVRCSTRAAFRSEARRARISHVSRAALRLPVILCPGALAATAALYAAPRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.33
3 0.38
4 0.36
5 0.34
6 0.36
7 0.45
8 0.46
9 0.54
10 0.5
11 0.55
12 0.61
13 0.6
14 0.66
15 0.67
16 0.68
17 0.67
18 0.71
19 0.7
20 0.74
21 0.81
22 0.74
23 0.68
24 0.63
25 0.59
26 0.55
27 0.5
28 0.39
29 0.32
30 0.3
31 0.26
32 0.22
33 0.18
34 0.16
35 0.14
36 0.15
37 0.16
38 0.19
39 0.2
40 0.19
41 0.16
42 0.16
43 0.15
44 0.15
45 0.14
46 0.12
47 0.1
48 0.11
49 0.12
50 0.11
51 0.11
52 0.1
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.1
70 0.13
71 0.15
72 0.16
73 0.15
74 0.15
75 0.16
76 0.16
77 0.17
78 0.18
79 0.16
80 0.15
81 0.15
82 0.15
83 0.15
84 0.13
85 0.1
86 0.07
87 0.05
88 0.06
89 0.05
90 0.05
91 0.06
92 0.1
93 0.1
94 0.11
95 0.12
96 0.14
97 0.17
98 0.22
99 0.21
100 0.21
101 0.21
102 0.23
103 0.25
104 0.26
105 0.3
106 0.28
107 0.34
108 0.33
109 0.32
110 0.3
111 0.28
112 0.25
113 0.19
114 0.16
115 0.1
116 0.09
117 0.08
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.13
124 0.15
125 0.16
126 0.16
127 0.15
128 0.15
129 0.15
130 0.14
131 0.07
132 0.06
133 0.06
134 0.07
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.09
142 0.12
143 0.15
144 0.17
145 0.19
146 0.2
147 0.23
148 0.24
149 0.26
150 0.32
151 0.28
152 0.28
153 0.28
154 0.31
155 0.3
156 0.28
157 0.25
158 0.18
159 0.2
160 0.19
161 0.2
162 0.2
163 0.24
164 0.25
165 0.25
166 0.22
167 0.21
168 0.2
169 0.17
170 0.14
171 0.1
172 0.1
173 0.1
174 0.1
175 0.09
176 0.09
177 0.09
178 0.08
179 0.06
180 0.06
181 0.05
182 0.05
183 0.04
184 0.04
185 0.05
186 0.05
187 0.05
188 0.06
189 0.08
190 0.1
191 0.14
192 0.15
193 0.16
194 0.17
195 0.21
196 0.23
197 0.23
198 0.24
199 0.25
200 0.25
201 0.23
202 0.23
203 0.2
204 0.22
205 0.23
206 0.25
207 0.27
208 0.28
209 0.29
210 0.32
211 0.4
212 0.36
213 0.35
214 0.34
215 0.28
216 0.27
217 0.27
218 0.22
219 0.13
220 0.13
221 0.11
222 0.07
223 0.06
224 0.06
225 0.05
226 0.05
227 0.06
228 0.06
229 0.06
230 0.09
231 0.09
232 0.09
233 0.11
234 0.12
235 0.16
236 0.17
237 0.19
238 0.19
239 0.21
240 0.2
241 0.21
242 0.21
243 0.17
244 0.18
245 0.18
246 0.17
247 0.2
248 0.2
249 0.21
250 0.25
251 0.26
252 0.25
253 0.25
254 0.26
255 0.31
256 0.35
257 0.36
258 0.37
259 0.41
260 0.49
261 0.56
262 0.6
263 0.56
264 0.58
265 0.56
266 0.57
267 0.61
268 0.56
269 0.56
270 0.56
271 0.55
272 0.52
273 0.53
274 0.49
275 0.42
276 0.37
277 0.32
278 0.26
279 0.23
280 0.24
281 0.21
282 0.18
283 0.15
284 0.15
285 0.11
286 0.1
287 0.08
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05