Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZY90

Protein Details
Accession A0A4Y9ZY90   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
156-176ITKTIRPTKPLPKRTRPGIEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR027921  NOPCHAP1  
Gene Ontology GO:0000492  P:box C/D snoRNP assembly  
Pfam View protein in Pfam  
PF15370  NOPCHAP1  
Amino Acid Sequences MASKKGKTVEKLEVESPEERVRRLQTAFENLNKSSAKASSTPTGAFDFGSRETFPVPPSHLLERVQAFLPEMEASNAQLLRQDPEAVDIENLGEDEEQYIEMNLGLGVFEQRKERNTTGSEDEGSESESDSSDDTSTTSDSASGSSDSEDDLILAITKTIRPTKPLPKRTRPGIEVLNESPIQQTSSTPNSPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.41
4 0.39
5 0.34
6 0.31
7 0.33
8 0.33
9 0.35
10 0.35
11 0.37
12 0.34
13 0.41
14 0.45
15 0.46
16 0.47
17 0.41
18 0.45
19 0.4
20 0.35
21 0.29
22 0.26
23 0.23
24 0.2
25 0.24
26 0.23
27 0.25
28 0.24
29 0.24
30 0.24
31 0.22
32 0.2
33 0.16
34 0.15
35 0.14
36 0.16
37 0.14
38 0.13
39 0.14
40 0.15
41 0.15
42 0.15
43 0.17
44 0.18
45 0.21
46 0.23
47 0.24
48 0.24
49 0.27
50 0.26
51 0.24
52 0.22
53 0.19
54 0.16
55 0.13
56 0.13
57 0.1
58 0.08
59 0.08
60 0.07
61 0.07
62 0.09
63 0.09
64 0.08
65 0.09
66 0.1
67 0.1
68 0.11
69 0.11
70 0.09
71 0.11
72 0.12
73 0.1
74 0.1
75 0.08
76 0.07
77 0.07
78 0.07
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.04
96 0.06
97 0.09
98 0.1
99 0.13
100 0.18
101 0.19
102 0.22
103 0.24
104 0.27
105 0.28
106 0.29
107 0.27
108 0.23
109 0.23
110 0.18
111 0.17
112 0.13
113 0.1
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.08
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.08
131 0.07
132 0.08
133 0.08
134 0.08
135 0.08
136 0.07
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.07
145 0.12
146 0.18
147 0.19
148 0.24
149 0.32
150 0.42
151 0.52
152 0.62
153 0.68
154 0.72
155 0.79
156 0.84
157 0.86
158 0.78
159 0.74
160 0.7
161 0.65
162 0.6
163 0.53
164 0.49
165 0.4
166 0.38
167 0.32
168 0.26
169 0.23
170 0.17
171 0.18
172 0.18
173 0.25