Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZPH9

Protein Details
Accession A0A4Y9ZPH9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-72AGELEKVRNRKKEKRAKEKAAFKKMFABasic
NLS Segment(s)
PositionSequence
51-69KVRNRKKEKRAKEKAAFKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MELNDADRTKALYRRGLAYGLLKEDDAAENALIEALTHAKDDKAIAGELEKVRNRKKEKRAKEKAAFKKMFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.34
4 0.32
5 0.31
6 0.28
7 0.24
8 0.22
9 0.18
10 0.16
11 0.16
12 0.14
13 0.11
14 0.09
15 0.07
16 0.06
17 0.06
18 0.06
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.05
26 0.05
27 0.05
28 0.06
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.12
35 0.13
36 0.19
37 0.22
38 0.27
39 0.33
40 0.42
41 0.5
42 0.56
43 0.65
44 0.71
45 0.78
46 0.83
47 0.88
48 0.9
49 0.92
50 0.92
51 0.92
52 0.93