Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A0Z4

Protein Details
Accession A0A4Z0A0Z4   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-43PPDCAKVHHKAPRKPGPRRRTRHCELRVARBasic
NLS Segment(s)
PositionSequence
21-35HHKAPRKPGPRRRTR
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MICVQELKLHLKGPPDCAKVHHKAPRKPGPRRRTRHCELRVARQKRLQPMEQLPPEYIVSSKKQHCGIPTLHYCVAVSADSLYSYAVKHSLVHKLEGHNVETVRYCGMLQAIHKLKQLSGAILLLEEPLWKADDSFLVARYSNYSYSYHMNKKGAPPDDRVFDIVRRELATTSTPKWYQIAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.41
4 0.44
5 0.5
6 0.49
7 0.56
8 0.56
9 0.57
10 0.61
11 0.71
12 0.77
13 0.78
14 0.83
15 0.84
16 0.86
17 0.87
18 0.9
19 0.89
20 0.88
21 0.87
22 0.87
23 0.83
24 0.82
25 0.77
26 0.78
27 0.79
28 0.75
29 0.73
30 0.68
31 0.67
32 0.66
33 0.68
34 0.6
35 0.57
36 0.57
37 0.6
38 0.57
39 0.53
40 0.44
41 0.39
42 0.36
43 0.28
44 0.23
45 0.17
46 0.17
47 0.22
48 0.25
49 0.27
50 0.3
51 0.31
52 0.32
53 0.34
54 0.32
55 0.33
56 0.33
57 0.34
58 0.31
59 0.3
60 0.28
61 0.23
62 0.21
63 0.14
64 0.1
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.07
76 0.09
77 0.15
78 0.16
79 0.18
80 0.19
81 0.2
82 0.25
83 0.25
84 0.24
85 0.2
86 0.19
87 0.18
88 0.16
89 0.15
90 0.11
91 0.1
92 0.08
93 0.07
94 0.07
95 0.08
96 0.08
97 0.15
98 0.19
99 0.2
100 0.23
101 0.23
102 0.22
103 0.26
104 0.26
105 0.18
106 0.16
107 0.14
108 0.12
109 0.11
110 0.11
111 0.06
112 0.06
113 0.05
114 0.04
115 0.05
116 0.06
117 0.06
118 0.06
119 0.07
120 0.08
121 0.11
122 0.12
123 0.13
124 0.13
125 0.13
126 0.14
127 0.16
128 0.18
129 0.16
130 0.17
131 0.17
132 0.18
133 0.23
134 0.31
135 0.35
136 0.39
137 0.4
138 0.42
139 0.47
140 0.53
141 0.55
142 0.51
143 0.51
144 0.5
145 0.51
146 0.49
147 0.45
148 0.39
149 0.35
150 0.36
151 0.32
152 0.29
153 0.26
154 0.26
155 0.24
156 0.24
157 0.26
158 0.26
159 0.26
160 0.32
161 0.32
162 0.32