Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0A0H6

Protein Details
Accession A0A4Z0A0H6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
257-278GAEQKKGKKARKGNKSKRGVAABasic
NLS Segment(s)
PositionSequence
261-274KKGKKARKGNKSKR
Subcellular Location(s) mito 14.5, cyto_mito 11.166, cyto_nucl 7.333, cyto 6.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR026258  SRP68  
IPR034652  SRP68-RBD  
IPR038253  SRP68_N_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0005047  F:signal recognition particle binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF16969  SRP68  
CDD cd15481  SRP68-RBD  
Amino Acid Sequences MTHGKGREFKKLPVISQDKLQDGHLQLLLFEAERAWAYSQELLALASKPENADNATGFRHNATGRFRRAVHWSTQLLSQCQSLFAGSRLSAEDLIEITVYTLILNGRFLRYREEFEDSLIQLSVARNLLDELASAATTSRDQALATYFADDIGPEIRYCAHELGHANAYDIDGIVAELSARHRQQIVEGYGQLVNKIRTEGEGAAQGLAKKKLQPLLWEGEPVPIRNPELVDVLLKVQDGEAKLKRENEEVSQTSVGAEQKKGKKARKGNKSKRGVAAYDSILLALSDAEDVARKLVEAQQASGSSSGVAGTRDIHFVHAFIVYQLLSRRIQRDLLLVSTLLSSHRAQAARPEHASKGKAASSKSQKEQVDSRLFPALVKLLDTALQSLNQMRVLAIVDDSPDLASAVDARIAFTNARRCYAPVKKFAEALTLIQHAHIHLRETRSILSTIETDPITTGDPAFYPLASDELAELENELSADALSLKNDWFAYNGGSVTQDSKTYTKPLFFDIALNYVQLDMDRLLERASKSKPVVVAPIPVRAEPVLEKKPTSRAKLEEIQRAPTPEPQAPGRGGLSSLLGGWWGRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.53
3 0.56
4 0.56
5 0.49
6 0.45
7 0.43
8 0.39
9 0.35
10 0.37
11 0.31
12 0.26
13 0.23
14 0.23
15 0.22
16 0.15
17 0.13
18 0.09
19 0.08
20 0.09
21 0.1
22 0.11
23 0.11
24 0.13
25 0.15
26 0.15
27 0.14
28 0.14
29 0.13
30 0.14
31 0.13
32 0.13
33 0.12
34 0.13
35 0.13
36 0.14
37 0.16
38 0.16
39 0.17
40 0.17
41 0.19
42 0.21
43 0.21
44 0.21
45 0.2
46 0.22
47 0.22
48 0.26
49 0.32
50 0.38
51 0.42
52 0.47
53 0.47
54 0.47
55 0.53
56 0.52
57 0.49
58 0.48
59 0.44
60 0.4
61 0.44
62 0.44
63 0.39
64 0.36
65 0.32
66 0.24
67 0.23
68 0.21
69 0.17
70 0.15
71 0.13
72 0.15
73 0.12
74 0.13
75 0.14
76 0.15
77 0.15
78 0.14
79 0.13
80 0.11
81 0.11
82 0.09
83 0.08
84 0.07
85 0.06
86 0.06
87 0.05
88 0.06
89 0.06
90 0.07
91 0.09
92 0.1
93 0.13
94 0.16
95 0.17
96 0.23
97 0.25
98 0.3
99 0.32
100 0.37
101 0.34
102 0.34
103 0.37
104 0.31
105 0.29
106 0.24
107 0.2
108 0.15
109 0.16
110 0.15
111 0.12
112 0.11
113 0.1
114 0.11
115 0.11
116 0.09
117 0.09
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.07
124 0.07
125 0.08
126 0.08
127 0.07
128 0.08
129 0.08
130 0.1
131 0.12
132 0.12
133 0.12
134 0.11
135 0.11
136 0.11
137 0.1
138 0.09
139 0.08
140 0.09
141 0.07
142 0.08
143 0.08
144 0.1
145 0.12
146 0.12
147 0.11
148 0.14
149 0.16
150 0.19
151 0.21
152 0.2
153 0.18
154 0.18
155 0.17
156 0.14
157 0.12
158 0.08
159 0.05
160 0.05
161 0.04
162 0.03
163 0.03
164 0.04
165 0.06
166 0.11
167 0.12
168 0.13
169 0.15
170 0.15
171 0.18
172 0.25
173 0.25
174 0.23
175 0.23
176 0.24
177 0.24
178 0.24
179 0.22
180 0.18
181 0.16
182 0.14
183 0.14
184 0.13
185 0.11
186 0.14
187 0.13
188 0.12
189 0.13
190 0.13
191 0.12
192 0.13
193 0.14
194 0.15
195 0.16
196 0.16
197 0.16
198 0.19
199 0.23
200 0.23
201 0.25
202 0.27
203 0.3
204 0.3
205 0.29
206 0.26
207 0.26
208 0.26
209 0.23
210 0.2
211 0.16
212 0.17
213 0.16
214 0.16
215 0.12
216 0.12
217 0.12
218 0.11
219 0.1
220 0.1
221 0.09
222 0.09
223 0.07
224 0.06
225 0.08
226 0.08
227 0.13
228 0.16
229 0.18
230 0.21
231 0.24
232 0.25
233 0.26
234 0.27
235 0.24
236 0.27
237 0.25
238 0.26
239 0.23
240 0.21
241 0.19
242 0.19
243 0.19
244 0.14
245 0.15
246 0.19
247 0.24
248 0.32
249 0.39
250 0.43
251 0.5
252 0.58
253 0.66
254 0.7
255 0.76
256 0.8
257 0.83
258 0.85
259 0.81
260 0.77
261 0.71
262 0.61
263 0.52
264 0.44
265 0.34
266 0.27
267 0.21
268 0.15
269 0.12
270 0.1
271 0.08
272 0.04
273 0.04
274 0.02
275 0.02
276 0.03
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.04
283 0.08
284 0.11
285 0.11
286 0.12
287 0.13
288 0.14
289 0.14
290 0.14
291 0.11
292 0.07
293 0.07
294 0.06
295 0.05
296 0.05
297 0.05
298 0.06
299 0.07
300 0.08
301 0.08
302 0.1
303 0.09
304 0.09
305 0.09
306 0.08
307 0.08
308 0.06
309 0.07
310 0.05
311 0.07
312 0.07
313 0.09
314 0.11
315 0.13
316 0.15
317 0.16
318 0.17
319 0.17
320 0.19
321 0.17
322 0.17
323 0.15
324 0.13
325 0.12
326 0.1
327 0.1
328 0.07
329 0.09
330 0.08
331 0.09
332 0.13
333 0.13
334 0.13
335 0.21
336 0.25
337 0.27
338 0.29
339 0.3
340 0.29
341 0.32
342 0.33
343 0.26
344 0.25
345 0.24
346 0.26
347 0.25
348 0.3
349 0.36
350 0.41
351 0.43
352 0.47
353 0.45
354 0.45
355 0.48
356 0.48
357 0.47
358 0.41
359 0.4
360 0.36
361 0.35
362 0.31
363 0.27
364 0.21
365 0.13
366 0.13
367 0.11
368 0.08
369 0.1
370 0.1
371 0.11
372 0.09
373 0.1
374 0.1
375 0.11
376 0.12
377 0.1
378 0.1
379 0.09
380 0.09
381 0.09
382 0.09
383 0.08
384 0.06
385 0.07
386 0.06
387 0.07
388 0.06
389 0.05
390 0.05
391 0.05
392 0.04
393 0.04
394 0.05
395 0.07
396 0.07
397 0.07
398 0.08
399 0.09
400 0.1
401 0.14
402 0.22
403 0.21
404 0.23
405 0.23
406 0.24
407 0.32
408 0.41
409 0.43
410 0.44
411 0.48
412 0.48
413 0.49
414 0.48
415 0.44
416 0.35
417 0.3
418 0.24
419 0.2
420 0.19
421 0.17
422 0.17
423 0.13
424 0.16
425 0.15
426 0.15
427 0.17
428 0.2
429 0.22
430 0.24
431 0.25
432 0.23
433 0.23
434 0.21
435 0.19
436 0.18
437 0.16
438 0.17
439 0.15
440 0.13
441 0.13
442 0.13
443 0.13
444 0.11
445 0.1
446 0.08
447 0.08
448 0.11
449 0.11
450 0.1
451 0.09
452 0.09
453 0.1
454 0.1
455 0.1
456 0.07
457 0.08
458 0.08
459 0.07
460 0.08
461 0.06
462 0.06
463 0.06
464 0.06
465 0.05
466 0.04
467 0.05
468 0.05
469 0.06
470 0.06
471 0.07
472 0.07
473 0.1
474 0.1
475 0.1
476 0.11
477 0.11
478 0.13
479 0.13
480 0.13
481 0.11
482 0.12
483 0.13
484 0.14
485 0.14
486 0.13
487 0.15
488 0.18
489 0.2
490 0.24
491 0.26
492 0.28
493 0.28
494 0.31
495 0.31
496 0.29
497 0.3
498 0.26
499 0.27
500 0.23
501 0.22
502 0.18
503 0.14
504 0.14
505 0.1
506 0.1
507 0.07
508 0.1
509 0.11
510 0.11
511 0.12
512 0.16
513 0.18
514 0.23
515 0.26
516 0.3
517 0.32
518 0.35
519 0.37
520 0.36
521 0.41
522 0.37
523 0.42
524 0.36
525 0.42
526 0.39
527 0.36
528 0.35
529 0.29
530 0.29
531 0.26
532 0.32
533 0.32
534 0.33
535 0.36
536 0.37
537 0.47
538 0.52
539 0.54
540 0.53
541 0.51
542 0.56
543 0.62
544 0.67
545 0.67
546 0.62
547 0.61
548 0.58
549 0.57
550 0.51
551 0.49
552 0.47
553 0.4
554 0.42
555 0.4
556 0.41
557 0.38
558 0.39
559 0.34
560 0.29
561 0.25
562 0.22
563 0.2
564 0.15
565 0.14
566 0.1
567 0.1