Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZX72

Protein Details
Accession A0A4Y9ZX72    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-121PLDLRPKKTRAIRRRLTPHEKSLKTVKQHKKDIHFPQRKFBasic
NLS Segment(s)
PositionSequence
86-115RPKKTRAIRRRLTPHEKSLKTVKQHKKDIH
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPEKRVKAYELQSKSKNDLSAHLKELKNELLTLRVQKIAGGSASKLTKINSVRKSIARVLTVTNQKQRQNLREFYKNKKYLPLDLRPKKTRAIRRRLTPHEKSLKTVKQHKKDIHFPQRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.54
4 0.45
5 0.46
6 0.44
7 0.43
8 0.43
9 0.47
10 0.43
11 0.4
12 0.43
13 0.38
14 0.32
15 0.28
16 0.24
17 0.19
18 0.21
19 0.23
20 0.21
21 0.19
22 0.18
23 0.18
24 0.18
25 0.16
26 0.15
27 0.12
28 0.1
29 0.13
30 0.14
31 0.14
32 0.15
33 0.14
34 0.19
35 0.23
36 0.32
37 0.32
38 0.36
39 0.39
40 0.39
41 0.43
42 0.41
43 0.39
44 0.31
45 0.27
46 0.25
47 0.27
48 0.32
49 0.31
50 0.33
51 0.36
52 0.37
53 0.41
54 0.45
55 0.46
56 0.46
57 0.5
58 0.49
59 0.54
60 0.56
61 0.6
62 0.65
63 0.63
64 0.57
65 0.58
66 0.55
67 0.54
68 0.57
69 0.57
70 0.58
71 0.62
72 0.7
73 0.66
74 0.66
75 0.65
76 0.67
77 0.68
78 0.67
79 0.69
80 0.69
81 0.74
82 0.82
83 0.85
84 0.86
85 0.81
86 0.81
87 0.81
88 0.74
89 0.69
90 0.68
91 0.65
92 0.64
93 0.68
94 0.69
95 0.68
96 0.76
97 0.79
98 0.78
99 0.81
100 0.84
101 0.84
102 0.84
103 0.76
104 0.76
105 0.78