Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9ZKS5

Protein Details
Accession A0A4Y9ZKS5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRILGHKRGKRNTRPNTSLLHydrophilic
NLS Segment(s)
PositionSequence
16-19KRGK
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRILGHKRGKRNTRPNTSLLQIEGVASKEDAQFYLGKRVAYVYRAKKEVHGSKVRVIWGRVTRSHGGSGAVKSKFRSNLPPSSFGATVRIMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.2
19 0.17
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.26
38 0.25
39 0.27
40 0.3
41 0.3
42 0.31
43 0.39
44 0.42
45 0.42
46 0.43
47 0.41
48 0.43
49 0.46
50 0.46
51 0.4
52 0.35
53 0.33
54 0.32
55 0.34
56 0.32
57 0.35
58 0.34
59 0.33
60 0.34
61 0.28
62 0.25
63 0.23
64 0.24
65 0.26
66 0.25
67 0.25
68 0.26
69 0.3
70 0.32
71 0.33
72 0.4
73 0.39
74 0.47
75 0.5
76 0.53
77 0.5
78 0.5
79 0.48
80 0.39
81 0.36
82 0.27
83 0.24
84 0.2
85 0.18
86 0.14