Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0A8A9

Protein Details
Accession A0A4Z0A8A9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
140-162DDLTRRRRKAARKWMTRTTCRDCHydrophilic
NLS Segment(s)
PositionSequence
145-151RRRKAAR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPPPPESSTLTDAPEPGGQVPQSADALAQGLAPQAESIAPVNDDGAKIQALHVTPAQMMEFFQALPEVLVRSKRARKDDEGEDSAPQKKCAATDGEAVPSCKPEEASSSGIKHEVDNEDEEDEEEFEDPELEVGLPDDLDDLTRRRRKAARKWMTRTTCRDCYRTIWEDDYFEYKSGQCEDCERASFGFPPLDEMGGELEVEGEWGESDEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.17
4 0.18
5 0.15
6 0.15
7 0.16
8 0.15
9 0.15
10 0.13
11 0.12
12 0.09
13 0.1
14 0.09
15 0.08
16 0.06
17 0.07
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.11
37 0.1
38 0.12
39 0.12
40 0.12
41 0.11
42 0.12
43 0.12
44 0.09
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.09
57 0.12
58 0.19
59 0.25
60 0.31
61 0.37
62 0.41
63 0.45
64 0.49
65 0.53
66 0.53
67 0.51
68 0.46
69 0.42
70 0.39
71 0.4
72 0.34
73 0.28
74 0.22
75 0.18
76 0.17
77 0.18
78 0.19
79 0.14
80 0.18
81 0.18
82 0.2
83 0.2
84 0.21
85 0.19
86 0.16
87 0.15
88 0.11
89 0.1
90 0.08
91 0.1
92 0.13
93 0.16
94 0.17
95 0.17
96 0.18
97 0.18
98 0.18
99 0.15
100 0.14
101 0.12
102 0.11
103 0.12
104 0.12
105 0.12
106 0.11
107 0.12
108 0.1
109 0.08
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.04
126 0.04
127 0.06
128 0.08
129 0.17
130 0.23
131 0.24
132 0.3
133 0.37
134 0.46
135 0.56
136 0.65
137 0.67
138 0.72
139 0.79
140 0.83
141 0.85
142 0.83
143 0.81
144 0.77
145 0.76
146 0.7
147 0.66
148 0.58
149 0.54
150 0.55
151 0.51
152 0.46
153 0.41
154 0.37
155 0.36
156 0.36
157 0.35
158 0.28
159 0.24
160 0.22
161 0.18
162 0.19
163 0.22
164 0.21
165 0.18
166 0.21
167 0.25
168 0.27
169 0.29
170 0.28
171 0.25
172 0.26
173 0.26
174 0.24
175 0.23
176 0.19
177 0.22
178 0.21
179 0.2
180 0.18
181 0.17
182 0.16
183 0.13
184 0.13
185 0.08
186 0.07
187 0.06
188 0.07
189 0.06
190 0.04
191 0.04
192 0.05