Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9ZGW7

Protein Details
Accession A0A4Y9ZGW7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-96GDKIPRARWRDRQRRDRAGHPRQBasic
NLS Segment(s)
PositionSequence
75-106DKIPRARWRDRQRRDRAGHPRQGAGGRRARGP
Subcellular Location(s) mito 18, pero 3, cyto 2.5, cyto_nucl 2.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR044152  YqjM-like  
Gene Ontology GO:0010181  F:FMN binding  
GO:0050661  F:NADP binding  
GO:0003959  F:NADPH dehydrogenase activity  
Amino Acid Sequences MPIFRRISATNWLQASLPNELSWALDDTVRLAPLLAAHGVDFLDISGGAHPAQKLNRQDAYQVPLSAAVKHAHGDKIPRARWRDRQRRDRAGHPRQGAGGRRARGPHVPEGLGAVWSFLDQLGVAIHKASQLQWAFKMRRPAPSAEKVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.27
4 0.24
5 0.18
6 0.17
7 0.17
8 0.17
9 0.15
10 0.15
11 0.11
12 0.1
13 0.1
14 0.12
15 0.13
16 0.13
17 0.11
18 0.09
19 0.09
20 0.09
21 0.1
22 0.08
23 0.07
24 0.06
25 0.07
26 0.07
27 0.06
28 0.06
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.07
37 0.07
38 0.1
39 0.12
40 0.18
41 0.21
42 0.25
43 0.27
44 0.27
45 0.29
46 0.29
47 0.3
48 0.26
49 0.23
50 0.18
51 0.18
52 0.18
53 0.15
54 0.15
55 0.11
56 0.1
57 0.11
58 0.12
59 0.1
60 0.11
61 0.13
62 0.16
63 0.23
64 0.26
65 0.31
66 0.36
67 0.41
68 0.5
69 0.58
70 0.64
71 0.67
72 0.75
73 0.78
74 0.83
75 0.81
76 0.81
77 0.81
78 0.8
79 0.78
80 0.69
81 0.6
82 0.53
83 0.54
84 0.48
85 0.44
86 0.41
87 0.35
88 0.36
89 0.36
90 0.36
91 0.37
92 0.36
93 0.36
94 0.33
95 0.31
96 0.28
97 0.29
98 0.26
99 0.21
100 0.17
101 0.11
102 0.08
103 0.07
104 0.07
105 0.05
106 0.05
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.15
118 0.17
119 0.2
120 0.25
121 0.34
122 0.37
123 0.4
124 0.5
125 0.46
126 0.52
127 0.54
128 0.56
129 0.56
130 0.63