Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0YFB7

Protein Details
Accession A0A4Z0YFB7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
167-195MPESKGTKAKLKKEKRKRKGKATASLESLHydrophilic
NLS Segment(s)
PositionSequence
92-97KAKKAK
171-187KGTKAKLKKEKRKRKGK
Subcellular Location(s) nucl 11.5, mito 10.5, cyto_nucl 8.833, cyto_mito 8.333, cyto 5
Family & Domain DBs
Amino Acid Sequences MLACMRFAPGYWRCFTGDATQTLRGLSMDSTGKAEISIPNAGISLYAYDSVANPTDTKTGPESGTTSAAQVSPQSSLLVRFGDSTPIKGTAKAKKAKKESADTNANCEIEASRLIGGGQPQDAVTGAAKAKKKLAKIFTISPGPTSSRTTTAATSPSGVEGPFRDPMPESKGTKAKLKKEKRKRKGKATASLESLGSAQDPFQDPEPMQLIDADDFRLEPLEDASWPIALPPDMRVLGFRKQEDEDEKRRKRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.34
4 0.34
5 0.34
6 0.36
7 0.36
8 0.35
9 0.33
10 0.31
11 0.23
12 0.19
13 0.14
14 0.14
15 0.13
16 0.14
17 0.16
18 0.15
19 0.15
20 0.14
21 0.15
22 0.13
23 0.14
24 0.15
25 0.13
26 0.13
27 0.13
28 0.13
29 0.11
30 0.1
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.1
38 0.11
39 0.1
40 0.1
41 0.11
42 0.14
43 0.14
44 0.16
45 0.17
46 0.18
47 0.18
48 0.19
49 0.2
50 0.18
51 0.21
52 0.19
53 0.16
54 0.14
55 0.14
56 0.13
57 0.12
58 0.11
59 0.09
60 0.09
61 0.1
62 0.09
63 0.1
64 0.11
65 0.11
66 0.1
67 0.11
68 0.11
69 0.17
70 0.17
71 0.18
72 0.18
73 0.21
74 0.21
75 0.22
76 0.28
77 0.28
78 0.36
79 0.43
80 0.47
81 0.52
82 0.59
83 0.63
84 0.63
85 0.62
86 0.6
87 0.6
88 0.63
89 0.55
90 0.53
91 0.49
92 0.43
93 0.36
94 0.3
95 0.22
96 0.14
97 0.14
98 0.09
99 0.06
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.06
113 0.06
114 0.11
115 0.12
116 0.13
117 0.18
118 0.21
119 0.24
120 0.29
121 0.32
122 0.33
123 0.36
124 0.38
125 0.37
126 0.38
127 0.35
128 0.3
129 0.27
130 0.24
131 0.22
132 0.22
133 0.19
134 0.18
135 0.2
136 0.21
137 0.2
138 0.2
139 0.2
140 0.17
141 0.16
142 0.14
143 0.12
144 0.11
145 0.1
146 0.09
147 0.08
148 0.11
149 0.11
150 0.11
151 0.12
152 0.12
153 0.15
154 0.2
155 0.25
156 0.25
157 0.29
158 0.34
159 0.36
160 0.43
161 0.47
162 0.51
163 0.56
164 0.65
165 0.7
166 0.77
167 0.86
168 0.88
169 0.92
170 0.92
171 0.93
172 0.92
173 0.91
174 0.9
175 0.86
176 0.81
177 0.74
178 0.65
179 0.54
180 0.44
181 0.34
182 0.24
183 0.17
184 0.11
185 0.07
186 0.09
187 0.11
188 0.12
189 0.14
190 0.16
191 0.16
192 0.2
193 0.23
194 0.2
195 0.18
196 0.17
197 0.16
198 0.15
199 0.16
200 0.13
201 0.1
202 0.1
203 0.1
204 0.1
205 0.09
206 0.08
207 0.09
208 0.1
209 0.1
210 0.12
211 0.12
212 0.11
213 0.11
214 0.11
215 0.11
216 0.11
217 0.11
218 0.11
219 0.16
220 0.16
221 0.16
222 0.19
223 0.21
224 0.28
225 0.34
226 0.34
227 0.33
228 0.35
229 0.42
230 0.48
231 0.52
232 0.55
233 0.6