Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0ZCA8

Protein Details
Accession A0A4Z0ZCA8   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-161VIVARRWIRREKTKDSLRRMNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 10.5, cyto 6.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011051  RmlC_Cupin_sf  
IPR007247  Ureidogly_lyase  
IPR024060  Ureidoglycolate_lyase_dom_sf  
Gene Ontology GO:0004848  F:ureidoglycolate hydrolase activity  
GO:0050385  F:ureidoglycolate lyase activity  
GO:0000256  P:allantoin catabolic process  
GO:0006144  P:purine nucleobase metabolic process  
Pfam View protein in Pfam  
PF04115  Ureidogly_lyase  
Amino Acid Sequences MLVRSIPLTEPLAITATPLTRDAFAPFGDVIANPRPASKPSNTAPEAIARGELPCGALSANQGTAIQYRAIASMRDLYSSAPSQKAGSARMTMFVCGARTLVSTDGGEADSIQAKVLERHPFTSQTFIPLTADGAKRYLVIVARRWIRREKTKDSLRRMNLGCRVVVSPTCGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.13
5 0.14
6 0.14
7 0.13
8 0.15
9 0.16
10 0.15
11 0.14
12 0.15
13 0.14
14 0.13
15 0.12
16 0.11
17 0.13
18 0.16
19 0.18
20 0.16
21 0.18
22 0.2
23 0.22
24 0.27
25 0.27
26 0.29
27 0.3
28 0.39
29 0.38
30 0.37
31 0.35
32 0.34
33 0.32
34 0.26
35 0.23
36 0.14
37 0.13
38 0.12
39 0.11
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.07
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.08
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.12
61 0.12
62 0.12
63 0.12
64 0.11
65 0.13
66 0.15
67 0.15
68 0.11
69 0.12
70 0.11
71 0.13
72 0.14
73 0.14
74 0.13
75 0.14
76 0.13
77 0.16
78 0.16
79 0.14
80 0.13
81 0.12
82 0.11
83 0.09
84 0.09
85 0.06
86 0.06
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.1
103 0.15
104 0.21
105 0.2
106 0.23
107 0.25
108 0.29
109 0.29
110 0.32
111 0.27
112 0.25
113 0.24
114 0.22
115 0.21
116 0.17
117 0.17
118 0.18
119 0.19
120 0.16
121 0.16
122 0.15
123 0.15
124 0.15
125 0.16
126 0.15
127 0.17
128 0.22
129 0.28
130 0.36
131 0.4
132 0.43
133 0.5
134 0.54
135 0.61
136 0.64
137 0.66
138 0.68
139 0.75
140 0.81
141 0.82
142 0.83
143 0.78
144 0.78
145 0.73
146 0.71
147 0.68
148 0.61
149 0.52
150 0.44
151 0.41
152 0.35
153 0.33