Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0Z6U0

Protein Details
Accession A0A4Z0Z6U0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
198-222EDSAVQNKRRTRPGKKHRIILRVREBasic
237-273VDKEQHLQEKKKRLNRERKLKRRQKEREKKVGLQITSBasic
NLS Segment(s)
PositionSequence
205-266KRRTRPGKKHRIILRVREKAKREREEAMKKLLVDKEQHLQEKKKRLNRERKLKRRQKEREKK
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFAFPEAKRVRRKDLYDSASDSAASDEETDHDSLAESAVRAKLNAQLSGLFNLSFAVGSGVQQQEADQSGAQPQPQAPSPVGDVQHEGEHPEGEAFAFRLFRDEAPTHTVVLTHDEDPGALGDGAFVVPSRPHSYYIASAPSPGEVSEYRSVAVTAEYLLADAKKRRWGLEKPWRVIHIMPDSNSASSKSTPGPTKEEDSAVQNKRRTRPGKKHRIILRVREKAKREREEAMKKLLVDKEQHLQEKKKRLNRERKLKRRQKEREKKVGLQITSPDGGGADDDSQKDVDEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.7
3 0.66
4 0.65
5 0.57
6 0.49
7 0.44
8 0.34
9 0.25
10 0.19
11 0.14
12 0.1
13 0.08
14 0.09
15 0.12
16 0.12
17 0.11
18 0.11
19 0.11
20 0.1
21 0.11
22 0.1
23 0.07
24 0.1
25 0.13
26 0.13
27 0.13
28 0.14
29 0.19
30 0.21
31 0.22
32 0.2
33 0.2
34 0.21
35 0.23
36 0.23
37 0.17
38 0.14
39 0.13
40 0.12
41 0.09
42 0.07
43 0.07
44 0.06
45 0.07
46 0.12
47 0.12
48 0.12
49 0.12
50 0.12
51 0.12
52 0.13
53 0.14
54 0.09
55 0.09
56 0.13
57 0.14
58 0.15
59 0.14
60 0.14
61 0.16
62 0.18
63 0.2
64 0.16
65 0.17
66 0.19
67 0.21
68 0.21
69 0.19
70 0.19
71 0.18
72 0.19
73 0.17
74 0.16
75 0.13
76 0.12
77 0.11
78 0.09
79 0.08
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.06
86 0.09
87 0.1
88 0.1
89 0.16
90 0.16
91 0.17
92 0.22
93 0.23
94 0.21
95 0.2
96 0.2
97 0.14
98 0.18
99 0.18
100 0.13
101 0.13
102 0.12
103 0.12
104 0.12
105 0.11
106 0.08
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.03
116 0.06
117 0.1
118 0.11
119 0.13
120 0.14
121 0.16
122 0.17
123 0.19
124 0.19
125 0.16
126 0.15
127 0.13
128 0.12
129 0.11
130 0.09
131 0.09
132 0.07
133 0.11
134 0.12
135 0.13
136 0.12
137 0.12
138 0.12
139 0.1
140 0.1
141 0.06
142 0.05
143 0.05
144 0.04
145 0.04
146 0.05
147 0.05
148 0.07
149 0.09
150 0.11
151 0.17
152 0.18
153 0.2
154 0.26
155 0.32
156 0.4
157 0.49
158 0.56
159 0.54
160 0.56
161 0.55
162 0.5
163 0.45
164 0.4
165 0.37
166 0.31
167 0.28
168 0.28
169 0.28
170 0.27
171 0.27
172 0.22
173 0.16
174 0.14
175 0.16
176 0.14
177 0.18
178 0.22
179 0.25
180 0.28
181 0.29
182 0.33
183 0.32
184 0.32
185 0.28
186 0.29
187 0.35
188 0.36
189 0.4
190 0.41
191 0.45
192 0.49
193 0.57
194 0.61
195 0.63
196 0.68
197 0.73
198 0.8
199 0.81
200 0.84
201 0.83
202 0.84
203 0.81
204 0.8
205 0.8
206 0.78
207 0.77
208 0.76
209 0.74
210 0.74
211 0.77
212 0.73
213 0.66
214 0.64
215 0.68
216 0.71
217 0.68
218 0.66
219 0.58
220 0.52
221 0.53
222 0.49
223 0.43
224 0.37
225 0.36
226 0.36
227 0.4
228 0.47
229 0.48
230 0.53
231 0.57
232 0.64
233 0.7
234 0.7
235 0.75
236 0.79
237 0.84
238 0.85
239 0.89
240 0.9
241 0.92
242 0.95
243 0.94
244 0.93
245 0.93
246 0.94
247 0.94
248 0.94
249 0.94
250 0.94
251 0.92
252 0.89
253 0.88
254 0.85
255 0.75
256 0.67
257 0.6
258 0.54
259 0.46
260 0.38
261 0.28
262 0.2
263 0.18
264 0.15
265 0.13
266 0.11
267 0.13
268 0.14
269 0.15
270 0.15
271 0.15