Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0Z7K4

Protein Details
Accession A0A4Z0Z7K4   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-75QEIRQKRERAHYKRRMAGKRBasic
NLS Segment(s)
PositionSequence
60-77QKRERAHYKRRMAGKRAR
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLGWTKAYRKAAGKEMTVDSTLQFAQRRNVPVRYDRGLWEKTMQAMTRIQEIRQKRERAHYKRRMAGKRARELAVDKKLVETHSHLLPRMRGSERRRLLEQGMDPEQIDQMEDTLPTEKAKVHGKEKLRQKLRVDGGVEFVGEENNGMEMDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.7
4 0.68
5 0.62
6 0.55
7 0.49
8 0.44
9 0.41
10 0.36
11 0.31
12 0.23
13 0.2
14 0.19
15 0.18
16 0.18
17 0.17
18 0.22
19 0.27
20 0.32
21 0.35
22 0.4
23 0.41
24 0.44
25 0.48
26 0.47
27 0.44
28 0.41
29 0.43
30 0.39
31 0.36
32 0.32
33 0.27
34 0.26
35 0.27
36 0.23
37 0.19
38 0.21
39 0.2
40 0.25
41 0.24
42 0.23
43 0.26
44 0.3
45 0.36
46 0.42
47 0.45
48 0.41
49 0.5
50 0.6
51 0.63
52 0.7
53 0.72
54 0.71
55 0.73
56 0.8
57 0.77
58 0.74
59 0.72
60 0.69
61 0.66
62 0.63
63 0.57
64 0.49
65 0.45
66 0.44
67 0.42
68 0.34
69 0.27
70 0.24
71 0.24
72 0.24
73 0.22
74 0.18
75 0.16
76 0.18
77 0.19
78 0.2
79 0.2
80 0.21
81 0.22
82 0.23
83 0.24
84 0.28
85 0.32
86 0.41
87 0.44
88 0.47
89 0.47
90 0.45
91 0.44
92 0.41
93 0.39
94 0.35
95 0.32
96 0.28
97 0.26
98 0.24
99 0.22
100 0.16
101 0.14
102 0.08
103 0.06
104 0.06
105 0.06
106 0.07
107 0.08
108 0.09
109 0.09
110 0.1
111 0.1
112 0.14
113 0.23
114 0.28
115 0.32
116 0.39
117 0.45
118 0.53
119 0.62
120 0.69
121 0.68
122 0.7
123 0.68
124 0.71
125 0.7
126 0.68
127 0.6
128 0.5
129 0.46
130 0.39
131 0.35
132 0.25
133 0.2
134 0.13
135 0.11
136 0.1
137 0.06
138 0.06
139 0.06