Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0YZN0

Protein Details
Accession A0A4Z0YZN0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
65-87GTPPSNSINKKRKKDVLKPIITTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNSAKDATNSDPAPAPAPATITVSKSAAIADINAINAAATPPSAQSTTLPLMAGANGSGTSSASGTPPSNSINKKRKKDVLKPIITTEGSAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.14
4 0.16
5 0.15
6 0.17
7 0.17
8 0.16
9 0.18
10 0.17
11 0.17
12 0.15
13 0.14
14 0.1
15 0.09
16 0.07
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.04
26 0.03
27 0.03
28 0.04
29 0.05
30 0.06
31 0.06
32 0.06
33 0.1
34 0.11
35 0.11
36 0.1
37 0.09
38 0.09
39 0.09
40 0.08
41 0.05
42 0.04
43 0.03
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.07
52 0.08
53 0.09
54 0.11
55 0.13
56 0.19
57 0.25
58 0.35
59 0.43
60 0.52
61 0.6
62 0.67
63 0.73
64 0.77
65 0.82
66 0.83
67 0.84
68 0.83
69 0.78
70 0.74
71 0.71
72 0.61
73 0.52