Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0YHZ5

Protein Details
Accession A0A4Z0YHZ5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
117-137ALPAKKTKKTPAKSTAKKGKLHydrophilic
NLS Segment(s)
PositionSequence
88-105AAQPKKRATAAKGKGKRK
121-136KKTKKTPAKSTAKKGK
Subcellular Location(s) nucl 11.5, cyto_nucl 11.5, cyto 8.5, mito 6
Family & Domain DBs
Amino Acid Sequences MPPKAAPKAAPKAENGELSETEKGVLSMAWQCFESEPKIDYDKLASLGGYTNIGSVMNIVRGAKKKLILDAVAAAGNNRQASASTSKAAQPKKRATAAKGKGKRKADDADNDDDSDALPAKKTKKTPAKSTAKKGKLASVNDEAEEDKEISDAEEDNDDDGEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.43
3 0.37
4 0.32
5 0.33
6 0.31
7 0.25
8 0.21
9 0.17
10 0.15
11 0.11
12 0.1
13 0.08
14 0.13
15 0.14
16 0.14
17 0.14
18 0.15
19 0.16
20 0.18
21 0.19
22 0.15
23 0.15
24 0.17
25 0.2
26 0.2
27 0.19
28 0.19
29 0.19
30 0.18
31 0.17
32 0.14
33 0.11
34 0.12
35 0.12
36 0.1
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.1
48 0.13
49 0.16
50 0.17
51 0.2
52 0.2
53 0.22
54 0.23
55 0.2
56 0.18
57 0.16
58 0.15
59 0.12
60 0.11
61 0.09
62 0.07
63 0.08
64 0.07
65 0.06
66 0.05
67 0.05
68 0.08
69 0.11
70 0.12
71 0.11
72 0.12
73 0.16
74 0.22
75 0.27
76 0.3
77 0.35
78 0.39
79 0.44
80 0.5
81 0.49
82 0.48
83 0.53
84 0.57
85 0.6
86 0.62
87 0.63
88 0.65
89 0.67
90 0.65
91 0.6
92 0.57
93 0.52
94 0.52
95 0.51
96 0.48
97 0.44
98 0.42
99 0.37
100 0.31
101 0.25
102 0.17
103 0.14
104 0.08
105 0.09
106 0.12
107 0.17
108 0.23
109 0.27
110 0.36
111 0.45
112 0.52
113 0.61
114 0.68
115 0.74
116 0.77
117 0.84
118 0.85
119 0.8
120 0.79
121 0.71
122 0.69
123 0.65
124 0.6
125 0.56
126 0.52
127 0.48
128 0.42
129 0.41
130 0.34
131 0.27
132 0.26
133 0.2
134 0.12
135 0.11
136 0.11
137 0.1
138 0.11
139 0.1
140 0.09
141 0.11
142 0.12
143 0.12